. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus

Automation tools for the documentation of large software packages" . Arushanyan O.B., Bogomolov N.A., Volchenskova N.I., Kovalev A.D. Some problems of documenting large software packages and a number of approaches to the automation of maintenance procedures for software documentation are considered. ... Arushanyan O.B. e-mail: arush@srcc.msu.ru ; Bogomolov N.A. e-mail: nbogom@srcc.msu.ru ; Volchenskova N.I. e-mail: nad1946@mail.ru ; Kovalev A.D. e-mail: kovalev@srcc.msu.ru ...

Еще в разделе: (Показать все результаты (>14) - num-meth.srcc.msu.ru/ )

• "ALIGNMENT IN FREE DECAYING MHD TURBULENCE"

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6977) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Издательство: American Chemical Society . ...

Еще в разделе: (Показать все результаты (>126) - istina.msu.ru/ )

• Journal of Documentation - журнал | ИСТИНА - Интеллектуальная Система

. If you wish to get this document direct from the mail based `info-server' please send a message to info-server@uk.ac.nsfnet-relay with a message containing the following body: Request: guestftp Topic: userguide Request: end . Topic userguide.ps will retrieve the PostScript version of the userguide, userguide will retrieve plain ASCII text.

Еще в разделе: (Показать все результаты (>57) - comet.sai.msu.ru/ )

• Some Useful Documentation
• Tools and documentation for Web designers
• WWW and Web Tools

... О UNИX . ... Неизменяемая страница . ... Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать страницы ------------------------ ... docinfo.html . ...

Еще в разделе: (Показать все результаты (>143) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_documentation_alt
• Index of /static/AltDocs_documentation_alt/images
• PspoMaterials/GFDL - UNИX

Search Pfam . ... Domain query . ... Pfam family ID . ... View FTP sites . ... Guide to domains . Create your own domain images . Changes from last release . Pfam MySQL documentation . Planned changes to Pfam . FAQ on Pfam . ... Description from UniProt for Q9KSG3_VIBCH . ... PfamA . ... Domain Image Key (in order of priority) . ... Overlapping Domains: Change the domain order using the ^ and v buttons. View the changes by clicking the 'Change order' button. high priority . ...

Еще в разделе: (Показать все результаты (>2002) - kodomo.cmm.msu.ru/ )

• Pfam: SwissPfam entry for Q9CN25_PASMU
• Pfam: SwissPfam entry for AAT_ECOLI
• Pfam: SwissPfam entry for AAT_PSEAE

. This document is designed to be viewed using the frames feature. If you see this message, you are using a non-frame-capable web client. Link to Non-frame version.

Еще в разделе: (Показать все результаты (>207) - angel.cs.msu.su/ )

• : API Help
• API Help
• DataTable

Databases (NSDC) of the Natural Planetary Satellites. ... NSDC: Database of astrometric observations of Natural Planetary Satellites . ... They are thoroughly looking for observations in different sources, creating their owndatabases which are then mostly inaccessible to other researchers. ... In the file "content" with explications, the reference is given to the data source as well as the bibliographic reference. ... Data sources. ... Why a specific bibliographic database for Natural satellites? ...

Еще в разделе: (Показать все результаты (>38) - lnfm1.sai.msu.ru/ )

• Data base of Natural Satellites. Documentation. Structure
• Data bases of Natural Satellites. Documentation. Sources
• Data bases of Natural Satellites. Documentation. Manual

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>27) - srcc.msu.ru/ )

• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Университетское образование в мире.Америка.Канада

. This documentation is missing. Please reinstall dev-util/cola with the 'doc' useflag enabled. Sincerely, . your package maintainer.

Еще в разделе: (Показать все результаты (>14630) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-texlive/
• Index of /pub/gentoo-portage/dev-texlive/texlive-documentation-finnish/
• Index of /pub/gentoo-portage/dev-texlive/texlive-documentation-chinese/

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>23) - curl.sai.msu.ru/ )

Руководство пользователя Линукса - попытка его перевода . Р. Бах: Архитекура ОС UNIX . STL - The Standard Template Library . QT - A nice library for X-window programming . Руководство по программированию в Линуксе - попытка перевода lpg . MAN по-русски . ПРОГРАММИРОВАНИЕ НА shell (А. Соловьев) . ПРОГРАММИРОВАНИЕ НА sed и awk (А. Соловьев) . Введение в Perl (Владимир Маслов) . MatLab online help

Еще в разделе: (Показать все результаты (>71) - xray.sai.msu.ru/ )

• AXAF-Chandra

LangueDOC . ... Кибрик А.Е. (ред.) Малые языки и традиции: существование на грани. ... Кибрик А.Е., Архипов А.В., Даниэль М.А., Кодзасов С.В., Майерс Том, Нахимовский А.Д. Технологии обработки языковых данных в документировании малых языков. ... Архипов А.В., Даниэль М.А., Кибрик А.Е., Нахимовский А.Д. Современные стандарты документирования малых языков. ... Кибрик А.Е. Проблема документирования 'малых' языков: теория и практика // Труды Отделения историко-филологических наук РАН. ... Paris, 2006. ...

Еще в разделе: (Показать все результаты (>77) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: How-To's

... All contacts alignment . ... Blue background means a contact with backbone phosphate. ... HBond with major groove + contact through a molecule of water with backbone phosphate; . ... contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + engagement in hydrophobic cluster + contact through a molecule of water with backbone phosphate; ...

Еще в разделе: (Показать все результаты (>239) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. 2013/04/02 - 4:30pm . ... Higher School of Management and Innovation (Faculty of Lomonosov MSU) was founded in June 2006 by the Academic Council on the initiative of the Moscow State University Rector, academician V.A. Sadovnichiy and Chairman of the Board of Directors of JSFC "Sistema" V.P. Yevtushenko. ... MSU website . ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>2) - hsmi.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

... Version: $Id: html-design.html,v 1.15 1994/11/26 19:53:43 connolly Exp $ . ... The HTML 2.0 Specification Review materials includes complete information on the HTML Working group of the IETF, the discussion of the HTML 2.0 specification, mailing list archive, and other supporting materials. ... JHU/APL's WWW HTML Developer's JumpStation - Page 1 . ... Gentle Introduction to SGML from the TEI guidelines. www-talk . ... There is also a hypertext archive. ... IETF Working group for HTML. www-html . ...

Еще в разделе: (Показать все результаты (>1422) - crydee.sai.msu.ru/ )

• Bugs found so far in XFree86/OS2 3.3.3
• Overview
• Bugs found so far in XFree86/OS2 3.3.1

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>71) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf