A program for alignment of structures of DNA-protein complexes . ... Help . ... StructAlign is a program for alignment of DNA-protein complexes' structures. The program gets a pair of complexes of DNA double helix with proteins in PDB-format and optionaly names of protein chains and outputs an alignment of DNA chains corresponding to the best spatial fit of protein chains also in PDB-format. ... X-axis is directed from P atom to C1' atom. ...

Еще в разделе: (Показать все результаты (>35) - mouse.genebee.msu.ru/ )

• StructAlign feedback
• ConClus
• About

... Master Education . ... Master programs . ... Master program "Mathematical Models of Complex Systems: Theory, Algorithms, Applications" . ... The Mathematical Models of Complex Systems: Theory, Algorithms and Applications Master?s programme is aimed at studying the foundations of computational methods and software for new types of current problems in modelling, decision-making, and control of complex systems. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>245) - hcs.cmc.msu.ru/ )

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>6329) - monkey.belozersky.msu.ru/ )

• DNA/RNA-Protein structures

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>12386) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• Geometrical core
• LCore

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>93) - www.intsys.msu.ru/ )

Электронная библиотека Попечительского совета . ... Rosenstark S. - Feedback Amplifier Principles . ... Название: Feedback Amplifier Principles . ... This book is intended for the electrical engineer interested in obtaining a background in the area of feedback amplifiers. ... Feedback amplifier, bridge feedback 32 . Feedback amplifier, bridge feedback, example 34 . Feedback amplifier, series-series 29 31 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>20127) - lib.mexmat.ru/ )

• Becker K.H., D?rfler M. - Dynamical Systems and Fractals : Computer Graphics
• Char B.W. - First Leaves: A Tutorial Introduction to Maple V :: Электронная
• Mejlbro L. - Complex Functions Examples c-2 - Analytic Functions :: Электронная

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>16) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

Additional topic data, program-generated or from TWikiForms , is stored embedded in the topic text using META: tags . ... Meta Data Syntax . Meta Data Specifications . ... META:FORM . ... By default, TWiki stores topics in files on disk, in a really simple and obvious directory structure. ... Order of fields within the meta variables is not defined, except that if there is a field with key name , this appears first for easier searching (note the order of the variables themselves is defined). ...

Еще в разделе: (Показать все результаты (>50326) - dualopt1.cmm.msu.ru/ )

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>146) - bioinf.fbb.msu.ru/ )

• SDPsite - PF07978
• SDPsite - PF01399
• SDPsite - PF01205

... Constants . Meaning of MPI s defined constants Note that the Fortran types should only be used in Fortran programs, and the C types should only be used in C programs. For example, it is in error to use MPI_INT for a Fortran INTEGER. Datatypes are of type MPI_Datatype in C and of tyep INTEGER in Fortran. ... INTEGER . ... return the maximum . ... Any error return . ... Error handler that returns error codes (as value of MPI routine in C and through last argument in Fortran) . ... Центры . ...

Еще в разделе: (Показать все результаты (>663) - www.parallel.ru/ )

• An Application Example | PARALLEL.RU - Информационно-аналитический центр по
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Programs fail after starting | PARALLEL.RU - Информационно-аналитический центр

This example continuously draws rectangles in a window and has another widget that counts the number of rectangles that are drawn per second. Id: forever.cpp,v 2.4 1998/06/16 11:39:32 warwick Exp $ ** ** Copyright (C) 1992-1998 Troll Tech AS. ... This file is part of an example program for Qt. ...

Еще в разделе: (Показать все результаты (>785) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - qmag/qmag.cpp example file
• Examples
• Qt Toolkit - connect/connect.cpp example file

The program of entrance examinations on chemistry in Moscow State University consists of two sections. The first section lists the basic theoretical concepts of chemistry, which can be used to predict chemical and physical properties of substances. ... The main classes of inorganic compounds: oxides, hydroxides, acids, salts. ... Classification of chemical reactions. ... Description of chemical properties should include main acid-base and redox reactions as well as qualitative reactions. ...

Еще в разделе: (Показать все результаты (>1154) - chem.msu.ru/ )

• HOCS-2004 Scientific Program
• The ARGENT Program System: A Second-Generation Tool Aimed at Systematic Search
• Structure and Interaction Energies of the Ar...Cl2 Complex. Application of the

... 4 from monomer import AminoAcidType . ... 21 * name -- str with the name of sequence . ... 44 def __init__ ( self , monomers = None , name = '' , description = "" ): . ... 102 def from_str ( fasta_str , name = '' , description = '' , monomer_kind = AminoAcidType ): . ... 191 def pdb_has ( self , chain , monomer ): . ... 194 def secstr_has ( self , chain , monomer ): . ... 198 def file_slice ( file , n_from , n_to , fasta_name = '' , name = '' , description = '' , monomer_kind = AminoAcidType ): . ...

Еще в разделе: (Показать все результаты (>43534) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 allpy/markups.py
• allpy: 8405ddf8f8c1
• allpy: log

Sequence alignment of non-superposable beta-sheets Evgeniy Aksianov Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia, evaksianov@gmail.com Andrey V. Alexeevski Belozersky Institute, Lomonosov Moscow State University, Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia aba@belozersky.msu.ru Protein 3D structures usually are more conserved than their sequences. ... Beta-strands are contained in sheet map rows. ...

Еще в разделе: (Показать все результаты (>330) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/171.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/6.pdf

... DSP board program forms all driving signals for DAC-ADC electronics and stepper motor controller. ... Driving signals formation is defined by scanning regime and by feedback parameters. ... Afterwards values of measured signal and feedback signal go to a computer for further analysis. The fact that feedback loop is closed on signal processor and computer doesn't participate in feedback signal evaluation allow to make feedback more stable and independent from computer work. ...

Еще в разделе: (Показать все результаты (>177) - www.spm.genebee.msu.ru/ )

• FemtoScan Online program
• Software structure

... The LanHEP input file is the sequence of statements, each starts with a special identifier (such as parameter, lterm etc) and ends with the full-stop ' . ... This section is aimed to clarify the syntax of LanHEP input files, i.e. the structure of the statements. ... Let us consider the LanHEP input files for the Standard Model with both the t'Hooft-Feynman and unitary gauges. ... LanHEP allows the user to define several keys , and use these keys to branch among several variants of the model. ...

Еще в разделе: (Показать все результаты (>2220) - theory.sinp.msu.ru/ )

• Reduce program
• The genEvents command
• Fortran case

MAKING THE PROFILES . First of all you are expected to load a FITS file ("FILE"-"LOAD"). ... By pressing the middle button you copy the profile from the first profile window to the second one. ... An example: first integral can correspond to the profile of active region and second integral can correspond to the profile of quiet chromospheric region. ... The second profile (which is subtracted from the first one) you extract after clicking on "SUBTRACT"-"MARK QUIET PROFILE" and marking the region. ...

Еще в разделе: (Показать все результаты (>409) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Structure
• Y.Kupryakov, SAI, MSU

... If there's no significant multiple alignment , including the sequence, that you interest, then the secondary structure is built, using only the energy model (just the potential energy of the system is minimized), but very often such method will give unreliable results. ... It should be mentioned that by default, at alignment case, the RNA secondary structure will be predicted for the first sequence of the alignment. ... It is done through optimizing, not the real, but model energy of the structure. ...

Еще в разделе: (Показать все результаты (>257) - www.genebee.msu.ru/ )

• IGLA-3D User Guide
• Screening of pattern or alignment against PROTEIN databank
• GeneBee service

To save the current mail message to a file: s junk . This saves the current mail message to the file junk in the current directory . To save several mail messages to the same file: s 5 8 14 project/feedback . This saves messages 5, 8 and 14 to the file feedback . ... To save all the messages from a particular user: s cayman xgator . This saves all the messages with the string cayman in the From: field of their message header to the file xgator . ...

Еще в разделе: (Показать все результаты (>591) - comet.sai.msu.ru/ )

• Examples of getting files with the ftp program
• Examples of sending files with the ftp program
• Examples of changing environment variables: Bourne shell

DVM-system of parallel program development . Goals and structure . ... 2.1 C-DVM and Fortran DVM parallel program development . ... Using C-DVM and Fortran-DVM languages a programmer deals with the only version of the program both for sequential and parallel execution. ... These rules are syntactically organized in such a manner that they are "transparent" for standard C and Fortran compilers and doesn't prevent DVM-program execution and debugging on workstations as usual sequential program. ...

Еще в разделе: (Показать все результаты (>166) - sp.cs.msu.ru/ )

• Fortran DVM compiler. Detailed design