... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>40) - analyt.chem.msu.ru/ )

Homepage: https://github.com/hazzik/livequery . ... expire signatures . ... For the second function it will be the element that is no longer matched. // matchedFn: the function to execute when a new element is matched $(selector).livequery( matchedFn ); // matchedFn: the function to execute when a new element is matched // unmatchedFn: the function to execute when an element is no longer matched $(selector).livequery( matchedFn, unmatchFn ); . ... This topic: System > JQueryPlugin > JQueryLiveQuery . ...

Еще в разделе: (Показать все результаты (>48967) - wiki.cmc.msu.ru/ )

• MetaData < System < Foswiki
• TimeSpecifications < System < Foswiki

... foreach(array_expression as $value) statement foreach(array_expression as $key => $value) statement . ... foreach example 1: value only */ $a = array (1, 2, 3, 17); foreach ($a as $v) { print Current value of \$a: $v.\n ; } /* foreach example 2: value (with key printed for illustration) */ $a = array (1, 2, 3, 17); $i = 0; /* for illustrative purposes only */ foreach ($a as $v) { print \$a[$i] = $v.\n ; } /* foreach example 3: key and value */ $a = ...

Еще в разделе: (Показать все результаты (>1147) - oit.cmc.msu.ru/ )

• version_compare
• preg_match_all
• xml_parse_into_struct

... No input file or projection information are needed. ... CYLINDRICAL PROJECTIONS : -Jc lon0 / lat0 / scale (Cassini) -Jj lon0 / scale (Miller) -Jm scale ( Mercator - Greenwich and Equator as origin) -Jm lon0 / lat0 / scale ( Mercator - Give meridian and standard parallel) -Joa lon0 / lat0 / azimuth / scale (Oblique Mercator - point and azimuth) -Job lon0 / lat0 / lon1 / lat1 / scale (Oblique Mercator - two points) -Joc Je lon0 / lat0 / scale (Equidistant). ...

Еще в разделе: (Показать все результаты (>606) - xray.sai.msu.ru/ )

• AXAF-Chandra
• Be/X-ray binaries and candidates
• Program of UISS-97

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Structure
• SAI Open Star Clusters (SAI OCL) Catalog

... About lab . ... MSU Graphics & Media Lab (Video Group) . The algorithm allows to increase video frame rate (fps) by the factor equal to any integer number. ... Frame rate conversion is done as shown on the picture below: . Frame rate conversion scheme . ... arbitrary whole number of interpolated frames between reference frames. ... Explicit scheme of occlusions detection improves visual quality of interpolated frames in areas near the frame edges. ... Video Frame Rate Double Up-Conversion . ...

Еще в разделе: (Показать все результаты (>861) - graphics.cs.msu.ru/ )

• High-quality increase of video color depth | Graphics and Media Lab
• GML LidarK Library | Graphics and Media Lab
• Removing of blocking effect from video | Graphics and Media Lab

University Satellites and . Space Science Education . ... The purpose of the developed scientific - educational program complex is creation on the Earth on the base of telemetry data of virtual model of microgravitational environment in which experiments are carried out, and virtual motion model of of the space vehicle. ... The developed program complex concerns to the class of the distributed program systems. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6714) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University
• University Satellites and Space Science Education '2006 I

... Recently we described a novel method for forming substrate-supported macroscopically-aligned lipid bilayers by self-assembling phospholipids into nanotubular structures inside ordered nanochannels of anodic aluminum oxide (AAO) [1]. We have also shown that these nanotubular bilayers retain many properties of unsupported bilayers and are suitable for incorporating transmembrane peptides and small membrane proteins [2]. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>111) - www.msm.biophys.msu.ru/ )

• Approved Presentations

Next] [Previous] [Top] [Contents] [Index] [netCDF Home Page] [Unidata Home Page] . ... The Unidata Program Center has developed a units library to convert between formatted and binary forms of units specifications and perform unit algebra on the binary form. Though the units library is self-contained and there is no dependency between it and the netCDF library, it is nevertheless useful in writing generic netCDF programs and we suggest you obtain it. ... Celsius . ... nit (unit of photometry) . ...

Еще в разделе: (Показать все результаты (>55) - angel.cs.msu.su/ )

• : Package ucar.multiarray
• Foreword
• Appendix B File Format Specification

... История кафедры . ... младших курсов . ... Уважаемые студенты 1-го, 2-го и 3-го курсов! ... Семинар кафедры проходит по пятницам в 15.20 в комн. ... а также на стендах кафедры на 2-м и 4-м этажах. Информацию о более ранних событиях см. в разделе "Жизнь кафедры" . ... 119991, Москва, Ленинские горы, д.1, стр.2, МГУ имени М.В.Ломоносова, физический факультет, кафедра фотоники и физики микроволн . ...

Еще в разделе: (Показать все результаты (>2) - photonics.phys.msu.ru/ )

... Physics Department . ... Topics of term papers for the 2nd year students ( in Russian ) . Information about the chair for students (pdf 14 Mb, in Russian ) . ... Laboratory Courses . ... History of Research in Polymer and Crystal Physics at the Physics Dept., ... Laboratory of Amphiphilic Polymer Systems Theory (in Russian) . Laboratory of Associating Polymers and Colloidal Systems . ... Laboratory of Computer-Based Methods in Research on Complex Polymer and Biopolymer Systems (in Russian) . ...

Еще в разделе: (Показать все результаты (>384) - polly.phys.msu.ru/ )

• SHORT ANNOTATION AND MAIN RESULT
• P.N.S.P.M. Lab. - Publications
• Laboratory of nonlinear, non-equilibrium and complex systems

... Institute Laboratory-Chairs . ... Laboratory-chair of causal mechanics . ... Two experimental setups for study of Kozyrev's transaction of the dissipative processes had been created. ... Existence of Kozyrev's transaction of the geophysical dissipative processes of various nature: synoptical, geoelectromagnetic, ionospheric ones and also the solar activity has experimentally been shown. ... Existence of retarded, zero and symmetrically advanced time lay in nonlocal transaction has been confirmed. ...

Еще в разделе: (Показать все результаты (>507) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Russian Interdisciplinary Temporology Seminar

The M.V. Lomonosov Moscow State University is organizing a traditional International Conference "BIOCATALYSIS-2007" in 17-22 June 2007 (preliminary dates were changed). ... Structure, catalytic mechanism and protein engineering of enzymes. ... EURO . ... In view of a limited number of ship cabin passengers, the Organizing Committee is asking to apply for participation at BIOCATALYSIS-2007 Conference, to send the Abstracts and to pay the Registration Fee not later than the deadlines indicated above. ...

Еще в разделе: (Показать все результаты (>171) - www.enzyme.chem.msu.ru/ )

... Invariant complex structures on generalized symmetric spaces Svjetlana Terziґ c University of Montenegro joint work with Dieter Kotschick (LMU - Munich) 1 1. ... In particular, if H is centralizer of a torus in G than G/H admits an invariant almost complex structure. ... On the numb er of invariant (almost) complex structures Thm 4 (Borel-Hirzebruch) Isotropy representation for G/H decomp oses into t irreducible summands G/H admits exactly 2t invariant almost complex structures. ...

Еще в разделе: (Показать все результаты (>218) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/talks/2005canberra-talk.pdf
• C*-algebras: Talks
• Conferences (English)

Thunderstorms and Elementary Particle Acceleration . ... Conference . The first announcement . ... The Thunderstorms and Elementary Particle Acceleration (TEPA-2012) conference is the second one devoted to the studies of the extreme atmospheric effects connected with amplification of electric fields in the lower atmosphere. ... TEPA-2012 conference will be held from July 9 till July 11, 2012, just after the 23rd European Cosmic Ray Symposium also organized by MSU ( http://ecrs2012.sinp.msu.ru ) . ...

Еще в разделе: (Показать все результаты (>2) - tepa2012.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>15) - storage.bioinf.fbb.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>22) - comphep.sinp.msu.ru/ )

• overview [CompHEP]

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>63) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG
• Unsolved problems and new prospects

... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... TPPMKOP is an utility developed for the automatic topology generation working well with OPLS-AA force field. ... This database is continually upgrading by our research group. ... OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория теоретической биофизики написал (Февраль 8th, 2016 4:27 дп) . ... All-atom automatic OPLS-AA topology generator . ...

Еще в разделе: (Показать все результаты (>50) - erg.biophys.msu.ru/ )

• Building and plotting Fukui function with FireFly and PyMol ERG Research Group:
• gromacs ERG Research Group: Лаборатория теоретической биофизики

... The Second International Luria Memorial Conference will be held from September 24 th to 27 th , 2002 in Moscow. ... The International Executive Committee includes: prof . E. Homskaya ( Russia ) prof . M. Cole (USA) - Copresidents; prof . T. Ahutina ( Russia ) - chair of the International Program Committee , prof . M. Bezrukih ( Russia ), prof . A. Brushlinsky ( Russia ), prof .A. Christensen (Denmark), prof . A. Dontsov ( Russia ), prof . D. Feldstein ( Russia ), prof . J. Glozman,...

Еще в разделе: (Показать все результаты (>162) - www.psy.msu.ru/ )