Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>1917) - www.sai.msu.su/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPlight
• Input Formats

Электронная библиотека Попечительского совета . ... Althaus E. - A branch-and-cut algorithm for multiple sequence alignment . ... Название: A branch-and-cut algorithm for multiple sequence alignment . Автор: Althaus E. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10817) - lib.mexmat.ru/ )

• Lander E.S., Waterman M.S. (eds.) - Calculating the Secrets of Life:
• Green J.A. - Sequences and series :: Электронная библиотека попечительского
• Green J.A. - Sequences And Series :: Электронная библиотека попечительского

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>204) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• Bioinformatics portal, Moscow State University
• GeneBee

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>2846) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SDP home page
• ETS_all_contacts alignment

... Results Comparison with FASTA archaean genomes. ... But each of these programs has some signicant Table 1: Numb er of found alignments with E-value less than given Program FASTA Nhunt Run time 5.5 1.4 Example alignment : Query: ctgtttaccaggtcaggtccggaaggaagcagccaaggcagatgacgcgt aaaaaaaa||||aa|||||a|a|aaa|||a||aa|| |||||||aa||a|||aa||a| Sbjct: ctgtgaaccagcttatcgccgcaatcaaacagccaaatcatatgcagcat Identity = 33/50 (66%) Strand: Plus/Minus Alignment features without scoring ...

Еще в разделе: (Показать все результаты (>33) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Comparison of protein phylogeny reconstruction methods

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6989) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• S : rm_systems
• Example of alignment

... Block DNA GyrB" shows the score of pairs Lys|Lys, Lys|Arg and Lys|Ser respectively, from a block constituted by amino acid sequences from the same protein (DNAGyraseB), but from different organisms, for example GYRB_ECOLI, GYRB_YERPE (yeast), GYRB_HEINE, GYRB_MUSC (mouse). Block 200 illustrates the score of these pairs from 200 different blocks constituted by sequences from differnet organisms. ... Between the values of single BLock the differences are smaller than between the values of Blosum62. ...

Еще в разделе: (Показать все результаты (>3895) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/bl2seq.html
• Global and Local Alignment of A.A Sequences
• Множественное выравнивание.

Sequence alignment of non-superposable beta-sheets Evgeniy Aksianov Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia, evaksianov@gmail.com Andrey V. Alexeevski Belozersky Institute, Lomonosov Moscow State University, Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia aba@belozersky.msu.ru Protein 3D structures usually are more conserved than their sequences. ... Beta-strands are contained in sheet map rows. ...

Еще в разделе: (Показать все результаты (>308) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/156.pdf

... 6 import sequence . ... 19 * self.alignment -- alignment object, which the block belongs to . ... 22 * self.positions -- list of positions of the alignment.body that . ... 34 def __init__ ( self , alignment , sequences = None , positions = None ): . ... sequences : . ... 75 If more than one pdb chain for some sequence provided, consider all of them . ... 129 alignment_sequence = self . ... 130 return ( alignment_sequence [ i ] for i in self . ... 132 def ca_atoms ( self , sequence , pdb_chain ): . ...

Еще в разделе: (Показать все результаты (>37405) - kodomo.fbb.msu.ru/ )

• allpy: fb3164f03984 lib/block.py
• allpy: ab9e2260a60a lib/block.py
• allpy: a016cad5f5a0 lib/block.py

... About lab . ... Video matting refers to a problem of accurate decomposition of given video sequence to background layer, foreground layer and transparency map. The VideoMatting project is the first online benchmark of video matting methods. ... Background . ... Ground-truth alpha (transparency map) . ... To obtain trimaps, we perform morphological operations on ground-truth (GT) alpha mattes and composites by placing ground-truth foregrounds over new backgrounds. ... multiline equation . ...

Еще в разделе: (Показать все результаты (>390) - graphics.cs.msu.ru/ )

• Video Matting Benchmark | Лаборатория компьютерной графики и мультимедиа
• MSU Video Codec Comparison | Graphics and Media Lab
• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... This section presents the results of the application of the methodology described in the previous section to real EEG signal. ... Fig. 7.1. Detection algorithm adapted for the EEG analysis . The EEG (a) was filtered in the alpha band (bandpass 7.5--12.5 Hz) (b) and then the amplitude squared (c); the result is the sequence from which the subintervals are cut out at further steps. ...

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Nonparametric approaches to the description of EEG piecewise stationary
• Unsolved problems and new prospects

Pleistocene Climatic Records of East and Central Asia Based on Micromorphological and Mineralogical Indicators of Loess-Paleosol Sequences . ... It is therefore necessary to study the sequences of processes in buried soils to provide information about pedogenesis as well as diagenesis. ... The loess-paleosol sequences of the Luochuan section, Shaanhi, China and of the Karamaydan and Chasmanigar sections in the Tajik Depression are well comparable especially for the Brunches chron. ...

Еще в разделе: (Показать все результаты (>120) - www.fadr.msu.ru/ )

Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit eutils flag-o-matic multilib toolchain-funcs EXTENSIONS = -without- extensions DESCRIPTION= Multiple sequence alignments using a variety of algorithms HOMEPAGE= http:// mafft .cbrc.jp/alignment/software/index.html SRC_URI= http:// mafft .cbrc.jp/alignment/software/${P}${ ...

Еще в разделе: (Показать все результаты (>16008) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/mafft/mafft-7.215.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc4304.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc4304.txt.pdf

... Method of recursive sequences in associated liquids theory . ... In case of chain association the comparison of RS-method with earlier developed matrix technique is performed. ... Moscow University Chemistry Bulletin . 2011, Vol. ... 3, P. 175 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>852) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• Moscow University Chemistry Bulletin Vol. 52, No. 1, P. 43 (2011)

Peremennye Zvezdy ( Variable Stars ) 32 , No. ... Photometric CCD observations of the pre-main-sequence Herbig Ae star WW Vul on separate nights during 2007-2011 are presented. ... Relative magnitudes of WW Vul were measured with respect of the comparison star. ... From top to bottom: (a) one night of observations of WW Vul: differences variable - comparison star and comparison star - check star; (b) de-trended light curve; (c) phase curve for the season 2011 with the first frequency, 9.34 d . ...

Еще в разделе: (Показать все результаты (>7225) - www.astronet.ru/ )

• La Palma Eclipse Sequence
• Bakasa Eclipse Sequence
• Alaska Aurora Sequence

... These functions all manipulate strings in various ways. ... bin2hex -- Convert binary data into hexadecimal representation . ... chr -- Return a specific character . ... convert_cyr_string -- Convert from one Cyrillic character set to another . count_chars -- Return information about characters used in a string . ... strncasecmp -- Binary safe case-insensitive string comparison of the first n characters . ... strncmp -- Binary safe string comparison of the first n characters . ...

Еще в разделе: (Показать все результаты (>209) - oit.cmc.msu.ru/ )

• strnatcmp
• strnatcasecmp

Comparison of iterative methods for solving sparse linear systems in filtration problems on computing systems with distributed memory" . ... Zhabitskiy Ya.V., Klimovsky A.A., Mirgasimov A.R., Semenko A.E. The performance and parallel scalability of BiCGSTAB, ORTOMIN and GMRES (including QGMRES and DQGMRES) algorithms are compared for SMP systems as well as for distributed memory and hybrid computing systems. The test procedures are conducted for nonsymmetric sparse systems of linear equations. ...

Еще в разделе: (Показать все результаты (>520) - num-meth.srcc.msu.ru/ )

• "A comparison of algorithms for spiral tomography"
• "Comparison of the Verlet table and cell-linked list algorithms for sequential,
• "On a posteriori accuracy estimates for solutions of linear ill-posed problems

... MATHEMATICAL AND SYSTEM BIOLOGY UDC 577.1 Membrane Profile-Based Probabilistic Method for Predicting Transmembrane Segments via Multiple Protein Sequence Alignment R. A. Sutormina and A. A. Mironova a b , b, c State Research Center GosNIIgenetika, Moscow, 117545 Russia; e-mail: sutor_ra@mail ... Bioinformatics, Moscow State University, Moscow, 119992 Russia Received January 25, 2006 Abstract--Prediction of transmembrane (TM) segments of amino ... Protein Sci. ... Proteins. ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

Sorex araneus from European Russia as inferred from mtDNA cytochrome b . DNA polymorphism within Sorex araneus from European Russia as inferred from mtDNA cytochrome b sequences . ... Genetic variation in the common shrew ( Sorex araneus ) in European Russia was studied using cytochrome b gene sequences. ... DNA Polymorphism within Sorex araneus and two congeneric species as inferred from inter-SINE-PCR // Mammalia. ... Genetic differentiation in Sorex. ...

Еще в разделе: (Показать все результаты (>1013) - zmmu.msu.ru/ )

• Geographical pattern and historical demography of Midday gerbil Meriones
• A preliminary study on molecular phylogeny of giant flying squirrels, genus
• Contribution to the species composition and taxonomic status of some Rattus