The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6992) - mouse.belozersky.msu.ru/ )

... Protein sequences . ... European ribosomal RNA database . ... Thermodynamic database for protein-nucleic acids interactions (Japan) . ... Families of structurally similar proteins . ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering complete protein sequences. ... Database issues of NAR: vol. 31 (2003) , vol. 32 (2004) , vol. 33 (2005) , vol. 34 (2006) , vol. 35 (2007) , vol. ...

Еще в разделе: (Показать все результаты (>1619) - monkey.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysus
• About COGs
• ETS sequence conservation

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>32) - seac47-2.phys.msu.ru/ )

• Pre-registration and abstract submission form

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• XAFS Publication Database search form

BLASTCLUST - BLAST score-based single-linkage clustering. ... BLASTCLUST automatically and systematically clusters protein or DNA sequences based on pairwise matches found using the BLAST algorithm in case of proteins or Mega BLAST algorithm for DNA. ... The primary input format for BLASTCLUST is a FASTA-format sequence file. ... Another type of input is a sequence hit-list previously saved by BLASTCLUST (in this case BLASTCLUST will use pre-computed HSP data instead of making de novo comparisons). ...

Еще в разделе: (Показать все результаты (>5035) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/rpsblast.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/term3/fasta_man.txt
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/impala.html

... Results Comparison with FASTA archaean genomes. ... But each of these programs has some signicant Table 1: Numb er of found alignments with E-value less than given Program FASTA Nhunt Run time 5.5 1.4 Example alignment : Query: ctgtttaccaggtcaggtccggaaggaagcagccaaggcagatgacgcgt aaaaaaaa||||aa|||||a|a|aaa|||a||aa|| |||||||aa||a|||aa||a| Sbjct: ctgtgaaccagcttatcgccgcaatcaaacagccaaatcatatgcagcat Identity = 33/50 (66%) Strand: Plus/Minus Alignment features without scoring ...

Еще в разделе: (Показать все результаты (>33) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Protein sequences: . ... OWL : non-redundant database assembled from a number of primary sources including translations of nucleic acid sequences (Swissprot, PIR, NRL3-D and GenPept). ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering all complete protein sequences in SwissProt. ... The Genome Sequence Database: complete relational database of DNA sequences and annotation . ...

Еще в разделе: (Показать все результаты (>152) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.22+ Services Help
• GeneBee BLAST 2.2.8 Services Help
• BLAST Basic Overview

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>313) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/39.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/222.pdf

... This document provides a set of guidelines for the administration and operation of public Network Information Center (NIC) databases. The purpose is to formalize procedures for the responsible handling of the personal and organizational information maintained by NICs in publically accessible databases, and to improve the accuracy and accessibility of such data where appropriate. ... The first part contains recommendations for preventing unauthorized disclosure of information in NIC databases. ...

Еще в разделе: (Показать все результаты (>19107) - mirror.msu.net/ )

Электронная библиотека Попечительского совета . ... Brown S.M. - Bioinformatics: A Biologist's Guide to Biocomputing and the Internet . ... Название: Bioinformatics: A Biologist's Guide to Biocomputing and the Internet . Автор: Brown S.M. Аннотация: . A practical overview of bioinformatics, for researchers. ... Also discusses and evaluated programs for PCs, the Internet, and mainframes. DLC: Bioinformatics. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9888) - lib.mexmat.ru/ )

• Lane D., Williams H.E. - Web Database Application with PHP and MySQL ::
• Bishop M.J. - Genetic Databases (Biological Techniques Series) :: Электронная
• Lander E.S., Waterman M.S. (eds.) - Calculating the Secrets of Life:

Pleistocene Climatic Records of East and Central Asia Based on Micromorphological and Mineralogical Indicators of Loess-Paleosol Sequences . ... It is therefore necessary to study the sequences of processes in buried soils to provide information about pedogenesis as well as diagenesis. ... The loess-paleosol sequences of the Luochuan section, Shaanhi, China and of the Karamaydan and Chasmanigar sections in the Tajik Depression are well comparable especially for the Brunches chron. ...

Еще в разделе: (Показать все результаты (>152) - www.fadr.msu.ru/ )

Изучение статистики наиболее длинной общей подпослеовательности двух случайных подпоследовательностей является одной из самых интересных и трудных задач вычислительной математической биологии. В докладе будут представлены результаты, касающиеся статистического распределения общих подпоследовательностей в упрощенном (некоррелированном) варианте модели, т.наз. модели Бернулли . ...

Еще в разделе: (Показать все результаты (>209) - polly.phys.msu.ru/ )

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>37019) - kodomo.fbb.msu.ru/ )

• allpy: 292b74612a42 allpy/sequence.py
• allpy: c3532d119351
• allpy: 292b74612a42 allpy/block.py

Related papers . ... N. N. Nepeyvoda, Logics and programming's styles (Russian, PDF). ... Abstract. ... D. Levshin Semantic Web and PostgreSQL Integration Algorithms (Russian, PDF). ... We consider Semantic Web and PostrgreSQL DBMS integration. Analysis of known systems for using databases with Semantic Web is performed, PostgreSQL features that can be useful for integration implementation are emphasized, integration methods and algorithms are proposed, and one of these algorithms is implemented. ...

Еще в разделе: (Показать все результаты (>129) - sp.cs.msu.ru/ )

Databases (NSDC) of the Natural Planetary Satellites. ... NSDC: Database of astrometric observations of Natural Planetary Satellites . ... They are thoroughly looking for observations in different sources, creating their owndatabases which are then mostly inaccessible to other researchers. ... In the file "content" with explications, the reference is given to the data source as well as the bibliographic reference. ... Data sources. ... Why a specific bibliographic database for Natural satellites? ...

Еще в разделе: (Показать все результаты (>234) - lnfm1.sai.msu.ru/ )

... The RADEN data bank produced at the Department of Chemistry of Moscow State University is designed as well to accumulate published information on radiative parameters of diatomic molecules, as to analyse it and recommend the more reliable values. ... electronic transition moments D ( R ); . ... dipole moments, . ... FACTUAL RECOMMENDED DATABASE contains now the ab initio and experimental electronic transition moments for more than 250 band systems which belong to more than 100 diatomic molecules. ...

Еще в разделе: (Показать все результаты (>48) - electr003.chem.msu.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... We found that automatic models are significantly worse at predicting attention than even single-observer eye tracking. We propose a semiautomatic approach that requires eye tracking of only one observer and is based on time consistency of the observer?s attention. ... Gitman Y, Erofeev M, Vatolin D, Bolshakov A, Fedorov A. Semiautomatic Visual-Attention Modeling and Its Application to Video Compression . ...

Еще в разделе: (Показать все результаты (>310) - graphics.cs.msu.ru/ )

• Semiautomatic Visual-Attention Modeling | Лаборатория компьютерной графики и
• Image Database Retrieval by Fast Hermite Projection Method | Graphics and Media
• Image Database Retrieval by Fast Hermite Projection Method | Лаборатория

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Chemists, Attention! Search on databases! ... Search on databases! [ re: olenka_chem ] . ... Search on databases! [ re: egoist ] . ... Из: IT UK CH . ...

Еще в разделе: (Показать все результаты (>1416) - www.fds-net.ru/ )

• Java Swing, Database - Public forum of MSU united student networks

... Alexey D. Neverov . ... Department of Bioengineering and Bioinformatics, Moscow State University. State Scientific Center GosNIIGenetika. ... EDAS human . EDAS mouse . EDAS dog (not availible now) . EDAS rat (not availible now) . To navigate this site please install the latest version of Macromedia Flash Player for Windows or for Linux . If you do not wish to install Flash you could use text pages with less functionality. ...

Еще в разделе: (Показать все результаты (>7) - edas2.bioinf.fbb.msu.ru/ )

• Alternative Splicing DataBase.
• EDAS (human) - Alternative Splicing DataBase.
• EDAS (mouse) - Alternative Splicing DataBase.

. ЭКОЛОГИЧЕСКАЯ ИНФОРМАЦИЯ . WEB- ориентированная библиографическая база данных .

Еще в разделе: (Показать все результаты (>30) - ecoinformatica.srcc.msu.ru/ )