. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus

AliGraf - GeneBee Graphical Alignment Help Type in a title for this session for you to remember. ... Type in an alignment algorith name (Genebee, ClustalW, Manual.. ... Even - all column space are colored; Sparse - every column is colored with respect to the column weight: less weight more space is left uncolored; Very sparse - more space is left uncolored. ... Also you can get a picture when only selected groups are colored. ... Group set depends on selected group type. ...

Еще в разделе: (Показать все результаты (>90) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee Graphical Alignment - Advanced
• Multiple alignment

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6986) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

... All contacts alignment . ... Blue background means a contact with backbone phosphate. ... HBond with major groove + contact through a molecule of water with backbone phosphate; . ... contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + engagement in hydrophobic cluster + contact through a molecule of water with backbone phosphate; ...

Еще в разделе: (Показать все результаты (>241) - monkey.belozersky.msu.ru/ )

• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus
• SVETKA, a program for multiple sequence alignments analysis

Scoring Matrices . Matrix Sequences Sequence Consisting of the first four Amino Acids in the Protein GYRB_ECOL: . ... Sequence Achieved by Substitution of the 2nd and 4th Amino Acid and Insertion between the 3d and 4th Amino Acid, in the Protein GYRB_ECOLI, to randomly chosen new amino acids: . ... Matrix Sequences Sequence Consisting of the First Nine Amino Acids of the Protein GYRB_ECOLI: . ... Sequence Consisting of 2nd, 3d, 7th, 8th and 9th Amino Acid Residues of the Protein GYRB_ECOLI: . ...

Еще в разделе: (Показать все результаты (>1582) - kodomo.cmm.msu.ru/ )

• Structure Alignment
• Alignment
• Multiple alignment

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Электронная библиотека Попечительского совета . ... Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of Liquid Crystal Devices . ... Название: Alignment Technologies and Applications of Liquid Crystal Devices . Авторы: Takatoh K., Hasegawa M., Itoh N. Аннотация: . ... Alignment Technologies and Applications of Liquid Crystal Devices demonstrates both the fundamental and practical aspects of alignment phenomena in liquid crystals. ...

Еще в разделе: (Показать все результаты (>263) - lib.mexmat.ru/ )

• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Hoque F. - The Alignment Effect: How to Get Real Business Value Out of
• Schmidt O.G. - Lateral Alignment of Epitaxial Quantum Dots :: Электронная

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Задача получить выравнивание вирусных белков, называемых "малыми дельта-антигенами", посредством программы muscle (читается "массл") и посмотреть на него в GeneDoc. ... Импортируйте файл в GeneDoc. ... Попробуйте разобраться с другими программами выравнивания, установленными на kodomo-count, а именно mafft и/или edialign . ... Посмотреть список программ пакета EMBOSS, имеющих отношения к выравниваниям, можно, выполнив команду wossname alignment Описание конкретной программы выдает программа tfm . ...

Еще в разделе: (Показать все результаты (>27858) - kodomo.fbb.msu.ru/ )

• allpy: lib/alignment.py diff
• Help to practice 9 (multiple alignment)
• Task 8 (Multiple alignment)

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>64) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>2) - num-meth.srcc.msu.ru/ )

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>10) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>7) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>25) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBoxLayout Class
• Qt Toolkit - QLabel Class

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>97) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - ClustalW
• SAL- Other Scientific Fields - Chemistry, Biology Related - DCSE
• SAL- Other Scientific Fields - Chemistry, Biology Related - SeqPup

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TablePlugin 10 - 2002-03-07 - PeterThoeny . ... Table cell spacing. ... Set CELLSPACING = 1 . ... 05 Jan 2002 PTh: Fixed sorting bug of cells with leading white space . 06 Dec 2001 PTh: Fixed date sorting bug . 03 Dec 2001 PTh: Fixed sort="off" bug and more . 29 Nov 2001: PTh fixed Perl warnings . 16 Nov 2001: PTh added table border, cell spacing, cell padding, gif files . ...

Еще в разделе: (Показать все результаты (>25225) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki
• VarTABLE - TWiki - TWiki - (printable)

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>127) - crydee.sai.msu.ru/ )

• Alignment, font styles, and horizontal rules in HTML documents

Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit eutils flag-o-matic multilib toolchain-funcs EXTENSIONS = -without- extensions DESCRIPTION= Multiple sequence alignments using a variety of algorithms HOMEPAGE= http:// mafft .cbrc.jp/alignment/software/index.html SRC_URI= http:// mafft .cbrc.jp/alignment/software/${P}${ ...

Еще в разделе: (Показать все результаты (>1035) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/mafft/mafft-7.215.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/clustalw-mpi/clustalw-mpi-0.13-r1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-chemistry/tm-align/tm-align-20140601.ebuild

... Planets In The Sun . ... Credit Copyright: SOHO - LASCO Consortium, ESA , NASA Explanation: Today , all five naked-eye planets (Mercury, Venus, Mars, Jupiter, Saturn) plus the Moon and the Sun will at least approximately line-up. ... And what about the Moon ? ... Publications with keywords: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . Publications with words: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . ... Neon Saturn . ... Moons and Jupiter . ...

Еще в разделе: (Показать все результаты (>2850) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Venus, Moon, and Neighbors
• Астронет > Venus, Moon, and Neighbors

PHP Manual . Prev . Next . unknown) SWFTextField->align -- Sets the text field alignment . void swftextfield->align ( int alignement) . ... This function is EXPERIMENTAL . ... Be warned and use this function at your own risk. swftextfield->align() sets the text field alignment to alignement . Valid values for alignement are : SWFTEXTFIELD_ALIGN_LEFT, SWFTEXTFIELD_ALIGN_RIGHT, SWFTEXTFIELD_ALIGN_CENTER and SWFTEXTFIELD_ALIGN_JUSTIFY. ... SWFTextField->setbounds . ...

Еще в разделе: (Показать все результаты (>7) - oit.cmc.msu.ru/ )