... Геология >> Геотектоника | ... Добавить новое сообщение . ... Учебное пособие "Введение в тектонофизику". Гончаров М. А., Талицкий В. Г., Фролова Н. С. Ответ. ... Тезисы научной конференции ЛОМОНОСОВСКИЕ ЧТЕНИЯ, ноябрь 2011 года СЕКЦИЯ ГЕОЛОГИЯ: . ...

Еще в разделе: (Показать все результаты (>5) - phys.web.ru/ )

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>64) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf
• http://www.msu.ru/science/details/2010/101021-moscow-how.pdf
• International Summer Schools at Lomonosov Moscow State University

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Back to the album list . Previous . Next Click the image to view it in fullsize. Previous . Next . ASM in twillight. Bright object above the tower is Venus, Mercury is just above the horizon and Saturn between them.

Еще в разделе: (Показать все результаты (>18) - site2010.sai.msu.ru/ )

• Information

SAO is Russia's main centre for ground-based space research. ... The basic instruments of the Observatory are the optical telescope BTA (Big Alt-azimuth Telescope) with a main mirror diameter of 6 m and the radio telescope RATAN-600 with the antenna diameter 600 m. Study of the Universe as a whole, analysis of non-stationary energy release in galactic and extragalactic objects of various types, investigation of evolution and chemical composition of our Galaxy and the nature of solar activity. ...

Еще в разделе: (Показать все результаты (>13) - www.issp.ac.ru/ )

• Problems of the 1-st International Astronomy Olympiad
• The International Olympiad of Euro-Asian Astronomical Society

... Написать комментарий . ... Полтораста быстрых звезд - кандидатов в MACHO . ... Астрономы группы MACHO (Massive Compact Halo Objects) открыли более полутораста близких к нам звезд с большим собственным движением. Поиск проводился в направлении на центр нашей Галактики и на Большое Магелланово Облако (БМО). ... За 7 лет А.Дрейк (Dr. Andrew J. Drake) из группы MACHO получил 50 тыс. снимков с 55 млн. звезд и нашел на них 154 быстрые звезды на расстояниях от 100 до 1000 св.лет (оценка) . ...

Еще в разделе: (Показать все результаты (>176) - www.nature.web.ru/ )

• Астероиды реально угрожают Земле
• Научная Сеть - Scientific Network
• Исправлены результаты Хаббла

... General ideas of classical game-theoretic analysis: Game in normal form (as a model of players interaction) -Several participants (players) - Several possible strategies for each player -Payoff functions Principle of Nash equilibrium (as a method to define agents strategies during their interaction) -Nash equilibrium is a basic concept of game theory. ... If is not an equilibrium then mutants with pure strategy that is a best reply to have grater payoff than the average payoff for the main...

Еще в разделе: (Показать все результаты (>14) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2013/FINAL/Program_ORM2013_ENG.pdf
• Кафедра Исследования Операций

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>4) - lab106.imec.msu.ru/ )

Roman Sutormin rsutormin@gmail.com Professional experience 05/2013 ­ present: Lawrence Berkeley National Laboratory (Berkeley, CA, USA) Software developer Development of JSON based storage system used for keeping biological data involved in public KBase services. ... 10/2009 ­ 08/2011: Mail.Ru Group (Moscow, Russia), Software developer Support and development of data warehouse (PostgreSQL) and administration web tool (JBoss + GWT) on serverside of MMO game "Allods Online". ... 2013 Jul 1514(1):476. ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~mazin/laci.fasta
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

... 10 PRINT HELLO WORLD 20 END program Hello (input, output) begin writeln(' Hello World ') end. # include stdio.h void main(void) { char *message[] = { Hello , World }; int i; for(i = 0; i 2; ++i) printf( %s , message[i]); printf( n ); } # include iostream.h # include string .h class string { private: int size; char *ptr; public: ... D % zmail all I need a "Hello, world." program by this afternoon. quit % % logout Bipppp ! ...

Еще в разделе: (Показать все результаты (>90) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | Позиция постдока в Университете Бергена,
• MMOnline | Форумы | Обсуждение сайта | TEX не скачивается
• MMOnline | Форумы | Разное | Куча Е-Буков

... Many of these planetesimals had metallic iron cores and during growth of the Earth this metal re-equilibrated with the Earth's silicate mantle, extracting siderophile (`iron-loving') elements into the Earth's iron-rich core. ... Chemical signature of core formation Growth of the Earth from planetary embryos and planetesimals resulted in the substantial partitioning of siderophile elements into the metallic core, leaving lithophile elements behind in the silicate mantle. ... REE, rare-earth elements....

Еще в разделе: (Показать все результаты (>14) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/stathyd/2005%20Smyth%20et%20al.%2C%20Differential%20diffusion%20in%20breaking%20Kelvin-Helmholtz%20billows.pdf
• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>3) - depni.sinp.msu.ru/ )

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3334.pdf
• http://library.biophys.msu.ru/matorin/3413.pdf
• http://library.biophys.msu.ru/PDF/3347.pdf

... Conferences . ... This conference is orientated towards academic and engineering experts in nonlinear dynamics, nonholonomic mechanics, classical and applied mechanics, systems with friction, biomechanics and related elds, with the focus on the cutting-edge theoretical research and the interaction between theory and practice. ... We will publish proceedings of the conference as a special issue of the journal Regular and Chaotic Dynamics. ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>113) - ics.org.ru/ )

... При этом все подпрограммы, вызываемые из целевой подпрограммы Библиотеки, запаковываются в один ZIP-файл с именем целевой подпрограммы. ... системных библиотечных модулей ( Math , SysUnils в системе DELPHI ), . ... Пояснения к тому как посмотреть описания библиотечных подпрограмм или переписать к себе текст подпрограммы см. в подразделах Пользователям Библиотеки , а также "О документации" и "Оформление подпрограмм" раздела "Организация Библиотеки". ...

Еще в разделе: (Показать все результаты (>35) - num-anal.srcc.msu.ru/ )

... Полная версия этой страницы: помогите скачать статью из IEEE . Студенческий форум Физфака МГУ > Наука физика > Есть проблема . ... 3.9.2010, 18:02 . Очень хочется прочесть статью "Ultrafast Fiber Laser Technology" в . Selected Topics in Quantum Electronics, IEEE Journal of . Issue Date: Jan. ... Volume: 15 Issue:1 . ...

Еще в разделе: (Показать все результаты (>627) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Вакансии ОКБ Бурстройпроект
• Студенческий форум Физфака МГУ > О макро-взаимодействиях, : 'не измышляя
• Студенческий форум Физфака МГУ > Программист, разработчик приложения на IOS

... The RELEC experiment was specially developed for study of relativistic electrons in near-Earth space together with TLEs in order to test possible connection between these two phenomena. ... Data from RELEC mission will be processed for testing TLE models, studying of TGF light curves and spectra, testing possible connection between electron precipitations and low-frequency electromagnetic waves. ... Energy range: 0.1 - 15 MeV (for electrons) . ...

Еще в разделе: (Показать все результаты (>2) - vernov-relec.sinp.msu.ru/ )

Preconcentration Laboratory . Laboratory of Chromatography . ... Laboratory of Kinetics Methods of Anaysis . ... Sorption-spectroscopy methods for determination of organic . ... Room-temperature ionic liquds, computational chemistry . ... New detection methods in ion and ion-pair chromatography . ... For that purpose, methods of selective preconcentration are developed along with the methods of determination of analytes directly in the sensing film or in the permeate after membrane diffusion. ...

Еще в разделе: (Показать все результаты (>33) - analyt.chem.msu.ru/ )

• Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert
• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by
• analyt

Intel Thread Checker 2- pozdneev@gmail.com . Intel Thread Checker 14 2008 1 / 26 1 Intel Thread Checker 1: Intel Thread Checker 2: Intel Thread Checker 14 2008 2 / 26 2 3 4 5 6 7 ( ) Microsoft Windows Intel Thread Checker / «» (Intel Software Development Tools Intel(R) Thread Checker x.x) icl ( Intel Software Development Tools Intel C++ Compiler xx.x.xxx C++ Build Environment for applications running on . ... 1 |Write -> |Err|4|omp|Memory read of glb_primes_found at |"prim|"prim| ... Read |or | ...

Еще в разделе: (Показать все результаты (>4) - angel.cmc.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>169) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis
• GeneBee BLAST 2.2.22+ Services Help
• GeneBee BLAST 2.2.8 Services Help