... On-line консультант . ... Приглашаем всех, интересующихся исследованиями и разработками в области компьютерных сетей, принять участие в семинаре по software-defined networking, который состоится 4 июля 2011 (понедельник) в 19.30 в Политехническом музее (Новая площадь, д 34;, подъезд 9, малая аудитория). ... We are about to witness a revolution in the networking towards so-called "Software Defined Networking" (SDN). SDN enables innovation in all kinds of networks . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>2) - erp.cmc.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

MPI. ... C: #include <mpi.h> 14 MPI MPI- C (case sensitive): error = MPI_Xxxxx(parameter,.. ... Send : , , ­ Receive: , , 27 MPI () MPI - , (blocking) (non-blocking) ­ Blocking: ­ Non-blocking: , 28 MPI (modes) (Mode) Synchronous send Buffered send Standard send Ready send Receive (Completion Condition) ( ), ( ) ( ), 29 MPI «-» () (MODE) Standard send Synchronous send Buffered send Ready send Receive MPI MPI _ Send MPI _ Ssend MPI _ Bsend MPI _ Rsend ...

Еще в разделе: (Показать все результаты (>6) - angel.cmc.msu.ru/ )

Reply to the Dr. Bazilevskaya refrees report (comments on Memorandum No 1 Comment Implicitly, the Model states that the proton event with the peak flux f30 = 0.12 proton/(cm2s sr) has, in average, the fluence F30 = 105 proton/cm2. ... We have shown, that besides the one GLE event, analyzed by Smart and Shea, rest 12 GLE events in 1989-1991 demonstrated, that uncorrected GOES high-energy data are rather overestimated, than on the contrary. ... Is it a first attempt to estimate the SEP model exactness. ...

Еще в разделе: (Показать все результаты (>6) - srd.sinp.msu.ru/ )

• http://srd.sinp.msu.ru/nymmik/models/ISOTS04.pdf
• Rikho Nymmik

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>2) - textbook.sinp.msu.ru/ )

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt

GRID WARPING FOR IMAGE SHARPENING USING ONE-DIMENSIONAL APPROACH Andrey Krylov, Alexandra Nasonova and Andrey Nasonov Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Email: kryl@cs.msu.ru ABSTRACT A new method for image sharpening via image warping is proposed. ... The aim of the proposed method is to transform edge points coordinates in such a way that the slope of the edge becomes steeper (see Fig. ...

Еще в разделе: (Показать все результаты (>102) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2011.ITSF.Krylov_Mizotin.Laguerre.en.pdf
• http://imaging.cs.msu.ru/pub/Superresolution08.pdf
• http://imaging.cs.msu.ru/pub/2015.OGRW.Krylov_Nasonova_Nasonov.Warping.en.pdf

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... For impatient users: You can download RusTeX in three different ways (Full installation; Selective download; Diskette-ready minimal installation) --- so at least read explanations about these methods before you download something. Please, use "Save link as" (right mouse button) for downloading files, otherwise .arj files and other binary files will be corrupted. ... TeX files are compact and readable in any text viewer: just text and commands for formatting and commands for equations drawing. ...

Еще в разделе: (Показать все результаты (>3) - tex.bog.msu.ru/ )

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>9) - iconolat13.phys.msu.ru/ )

• Housing and travel

Chemistry 460 Spring 2013 Dr. Jean M. Standard April 25, 2013 Basis Set Notation Using the LCAO-MO approximation, molecular orbitals can be represented as linear combinations of atomic orbitals, K i = µ =1 c µi f µ . 1) In this equation, the functions i are molecular orbitals, f µ are atomic orbitals, c µi are numerical coefficients, and K is the total number of atomic orbital functions (or basis functions). ... The orbital exponent controls the size of the basis function. ...

Еще в разделе: (Показать все результаты (>24) - erg.biophys.msu.ru/ )

• Using spherical functions (from A.Granovsky manual) ERG Research Group:

... Aptamer DNA : A New Type of Thrombin Inhibitors V. A. Spiridonova*,1 E. V. Rog**, T. N. Dugina***, S. M. Strukova***, and A. M. Kopylov** *Belozersky Institute of Physicochemical ... State University, Vorob'evy gory, Moscow, 119899 Russia Received November 13, 2002; in final form, November 21, 2002 Abstract--The formation of complexes between various thrombin preparations and 30-mer aptamer DNA was comparatively studied, and a correlation between the ... 5 2003 Vol. ... Vol. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf

... Second-year students classes . ... The course offers profound description of popular techniques of parallel programming such as OpenMP and MPI. ... Rapid growth of productivity of the modern computing systems is achieved by using parallel processors and multicore systems. ... As a result, by the and this course, students acquire knowledge about the popular parallel programming techniques, knowledge of modern high-performance computing systems and practical skills to work with them. ... Moscow: Binom...

Еще в разделе: (Показать все результаты (>14) - engineering.phys.msu.ru/ )

• Introduction to Linux

Psychology in Russia: State of the Art · 2012 Psychology of flight At tendAnt's Profession Tatyana V. Filipieva Association of Aviation, Space, Naval, Extremal and Environmental Medicine of Russia Moscow, Russia The profession of a flight attendant appeared in aviation in the 1920s. Professional community of flight attendants is constantly growing with the growth of complexity of aviation technology, professional standards of passenger service and safety. ... It was a 13-hour flight with two landings. ...

Еще в разделе: (Показать все результаты (>162) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2012/astaeva.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/ismagilova.pdf
• http://www.psy.msu.ru/science/psyrussia/2013/asmolov.pdf

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>12) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc
• Центр по делам России и США :: Публикации

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Home > Departments > ENG . ... The remarkable technological achievements and their strong impact on the international communication environment in the 21st century have made the English language proficiency especially essential for the graduates of Computational Mathematics and Cybernetics faculty. ... Foreign language teaching is a compulsory component of a modern professional training. ... The English Language curricula consist of two stages. ... Belikova Evgenia, Senior Lecturer, PhD . ...

Еще в разделе: (Показать все результаты (>115) - en.cs.msu.ru/ )

• Department of English | CMC MSU
• Laboratory of Programming Technologies | CMC MSU
• Laboratory of Programming Technologies

... only the sensors k in the simplest case); memory, in which evidence of the Interaction between the sensors and the identified object is imprinted, by forming the occasional imprint X of this object (it is not necessary to use the index of zone k, since other reception zones are not examined; and an inborn, a priori , (or, if ... Thus a new semiotic problem arises: the classification of objects and their patterns from possible sign situations in which two or more interpretors take part. ...

Еще в разделе: (Показать все результаты (>46) - old.philol.msu.ru/ )

• Using Markov Chains for Identification of Writers