... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>133) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Sources
• Data bases of Natural Satellites. Documentation. Structure

The Fall 2004 issue of The Fulbrighters' Newsletter is now available for download at http://www.fulbright.org/newsletter . The newsletter, published by the Fulbright Association several times a year, contains information on the activities and events of the Association, its affiliated chapters around the United States, and its sister Fulbright alumni organizations around the world. The newsletter also provides updates on Fulbright Association members in the Alumni Achievements section. ...

Еще в разделе: (Показать все результаты (>104) - www.prof.msu.ru/ )

• About the importance of founding teleecommunication centres in developing areas
• Conflict Transformation, Ngo And Networking
• Emerging global NGO-busines relations

... 24 Ноя 2015 . кем editor | ... 19 Окт 2015 . ... 3 Дек 2015 . ... Декабрь 2015 . Ноябрь 2015 . Октябрь 2015 . Сентябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>91) - elana.sinp.msu.ru/ )

• cheap moncler developed by examiners through their skills and expertise | С
• the north face outlet uk Legner said that companies should provide an automated
• cheap longcham | С Днем Победы!

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• NPG-explorer

... About lab . ... MSU Graphics & Media Lab (Video Group) . MSU StegoVideo allows to hide any file in a video sequence before compression and extract it after decompression with unknown codec. ... Small video distortions after hiding info . It is possible to extract info after video was compressed . ... compressed frame with hidden info - information was completely recovered! Quality of information extracted from compressed video depends on codec, data redundancy and frame size. ...

Еще в разделе: (Показать все результаты (>215) - graphics.cs.msu.ru/ )

• VQMT3D Project | Graphics and Media Lab
• Road monitoring | Graphics and Media Lab
• GML LidarK Library | Graphics and Media Lab

... sought for such use through Elsevier's permissions site at: http://www.elsevier.com/locate/permissionusematerial ARTICLE IN PRESS JOURNAL OF SOUND AND VIBRATION Journal of Sound and Vibration 298 (2006) 471 - 474 www.elsevier.com/locate/jsvi Short Communication Wolfhard Kliema, Alexei A. Mailybaevb,Г, Christian Pommer a copy Conditions revisited for asymptotic stability of pervasive damped linear ... In the case of an indefinite damping matrix, system (1) may be stable or unstable. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/reviews/Olhoff.pdf

Data are provided with the intent that they are readily available for personal and public non-commercial use and may be reproduced, in part or in whole and by any means, without charge or further permission from IWSG. However, proper reference to contributors of original data to the database must be provided in all cases, and due diligence should be exercised in ensuring the accuracy of the materials reproduced . ... Bird species report. In : ARCTIC BIRDS breeding conditions survey . ...

Еще в разделе: (Показать все результаты (>2) - arctic.ss.msu.ru/ )

... Preface to Research Project "High-Level Decision Making in the Soviet Administrative-Command Economy", . ... This introductory article summarizes the High-Level Soviet Decision Making Project of which the Lazarev and Belova papers are examples. It explains that social scientists must use the modern methods of information economics and the New Economic History to study the Soviet state and party archives using methods of interests to economists and political scientists in general. ...

Еще в разделе: (Показать все результаты (>82) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• Moscow State University. Faculty of History. About us.
• Economic History. Yearbook. 2001

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>61) - monkey.belozersky.msu.ru/ )

• SDP home page
• Example of supporting positions
• ETS numeration assumed

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>50) - brain.bio.msu.ru/ )

• Nonparametric approaches to the description of EEG piecewise stationary
• Spatial synchronization of the change-points
• Change-point synchronization between signals or signal components

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>7) - td.chem.msu.ru/ )

... We investigated if such complex and variable calls provide cues for the recognition of individuals, of sex and of breed in two indigenous breeds of Borzoi dogs: Hortaj Windhound from South Russia and Russian Borzoi from Middle Russia. ... Discriminant analysis of 1329 barks from 11 Hortaj and 8 Borzoi dogs (69-70 calls per individual) showed 63.5% of correct assignment to individuals. Separate values of correct assignment to individuals were 66.2% for Hortaj and 75.0% for Borzoi dogs. ...

Еще в разделе: (Показать все результаты (>51) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях
• Field Practice at the White Sea Biological Station

A Short Course in Differential Geometry and Topology A.T. Fomenko and A.S. Mishchenko sP A Short Course in Differential Geometry and Topology A.T . ... Partition of Unity 2.4.1 Functional separability 2.4.2 Partition of unity 3 CONTENTS 51 52 54 Smoot h Manifolds (General Theory ) 57 3.1 Concept of a Manifold 59 3.1.1 Main definitions 59 3.1.2 Functions of change of coordinates. ... Frenet formulae 4.1.2 Theory of spatial curves. ... Examples and illustrations are included throughout the chapter. ...

Еще в разделе: (Показать все результаты (>130) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/TTC/slides/ray.pdf
• http://higeom.math.msu.su/people/taras/mypapers/keldysh100en.pdf
• http://higeom.math.msu.su/people/ssmirnov/astana.pdf

... In 1997, the work of Jens Skou devoted to discovery and the study of Na,K-ATPase was culminated in the Nobel Prize. ... Our group works in the collaboration with the University of Montrel, Canada (professor S.N. Orlov), and with the Engelgardt Institute of Molecular Biology, Moscow, Russia (Laboratory of conformational stability of proteins and physical methods of analysis, under the guidance of academician A.A. Makarov). ... S-glutathionylation of the Na,K-ATPase catalytic ? ... Biochemistry (Mosc)...

Еще в разделе: (Показать все результаты (>19) - biochem.bio.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... Information unit (BI) . ... Information block is developed in order to provide operation of the scientific equipment complex onboard the ?Lomonosov? satellite and its operative and flexible control during the execution of the scientific program.љ ... complicated scientific equipment, huge volume of scientific information storage, high-operative control of the equipment, therefore it was necessary to develop a special information unit. ... Data exchange rate, (interface Ethernet), Gbit/s . ...

Еще в разделе: (Показать все результаты (>22) - lomonosov.sinp.msu.ru/ )

• BDRG | Университетский спутник "Ломоносов"

... Inofficial Mathematical Chemistry page by Eugene V. Babaev Moscow State University, Russia . ... Section 2 recalls several concepts of the graph theory and topology of surfaces, necessary for further discussion, and Section 3 is the overview of the common types of molecular graphs and molecular surfaces used in chemistry. ... The objects are some specific molecules with bipartite graphs (which follow so-called "alternation rule", and the operation is a polar chemical reaction. ... Chemistry . ...

Еще в разделе: (Показать все результаты (>123) - www.chem.msu.ru/ )

• Intuitive Chemical Topology Concepts

... 2015 . ... Submit your article . ... Ph.D., associate professor, School of Public Administration, Lomonosov Moscow State University. ... This article deals with such forms of interactive learning as business game and case study . ... Key feature of interactive teaching which differentiates it from traditional teaching is the active role of students whereas the teacher takes on a controlling function and summarises outcome of the learning session. ... Interactive teaching, case study, business game. ...

Еще в разделе: (Показать все результаты (>137) - ee-journal.spa.msu.ru/ )

Atmospheric transparency in the optical and near IR range above the Shatdzhatmaz summit O.Voziakova (Sternberg Astronomical Institute, Russia) Atmospheric extinction in the MASS spectral band Atmospheric transparency in near IR range Example of a good photometric night. ... Distribution of atmospheric extinction in MASS Median = 0.23 mag 1-st quartile = 0.20 3-d quartile = 0.27 mag Vertical green line represents theoretical Rayleigh extinction for Shatdzhatmaz (0.16 mag). ...

Еще в разделе: (Показать все результаты (>16) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf