The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>74) - geophys.geol.msu.ru/ )

• TRF_2d. Page 4.
• TES. Field example.
• TES tecnology. MSU.

... Sections . ... Atlas "Birds of Moscow City" . ... The 'Birds of Moscow and the Moscow Region' project operates in the Zoological Museum of Moscow State University since 1999. ... Atlas "Birds of Moscow City" Monitoring of common birds Breeding bird atlas of European Russia Birds of Moscow and the Moscow Region Photo-guide of birds of European Russia Invertebrate Zoology Entomology Ichthyology Herpetology Ornithology Mammalogy Evolutionary Morphology History of museum Collections For public visitors ...

Еще в разделе: (Показать все результаты (>1142) - zmmu.msu.ru/ )

• Collection of books
• Exhibition of Insects
• History of the Section

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>12) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское

Diploma thesis abstract. ... In this work the propagation and nonlinear interactions of nanosecond laser pulses in microstructure fibers are studied. Experiments presented in this diploma demonstrate the capability of hollow photonic crystal fibers to provide nanosecond laser pulses with a flow more than 500 J/cm2. Efficiency of nonlinear spectroscopy methods by the example of Coherent antiStokes Raman scattering was studied. ...

Еще в разделе: (Показать все результаты (>47) - ofvp.phys.msu.ru/ )

... 2 : 1 ґ , 2 ґ : 1 : 1) Define the subject of intercultural communication. What is the difference between intercultural and cross-cultural communication? ... 2) Define culture. ... Explain the role of metaphor in culture studies. ... 4) Enumerate the basic functions of culture. ... 13) Comment on the acute problems of intercultural communication in the modern Russian society 2 : 1) Was Edward Hall right to define communication as culture and culture as communication? ... 2) Define communication. ...

Еще в разделе: (Показать все результаты (>57) - ffl.msu.ru/ )

The Department of Talented Youth Affairs and Professional Orientation . ... The Central Election Commission of the Russian Federation in conjunction with the Ministry of Education and Science of the Russian Federation , the Foundation ?International Foundation for Legal Initiatives?, the election commissions of subjects of the Russian Federation , educational institutions of higher education of the Russian Federation , hold a ...

Еще в разделе: (Показать все результаты (>32) - talant.msu.ru/ )

• News | The Department of Talented Youth Affairs and Professional Orientation |

akishin@hep.sinp.msu.ru A major concern for spacecraft is internal electrostatic discharge (IESD), a form of spacecraft charging. ... 100 . ... 3-6] , 30-100 (1987-1989.) ... 1013 /2 30-100 [3]. 112,-120 120. 700, 25 ґ 100 , , 0,25 , 50, 120 . ... 105 /, ~51010 /2 [2]. 30 ~1010 /2 [ 2 ]. ... 100 ~1011 /2 50 , Jy = 1015 /2c. 30 J~105 /2c. , -100 , ~1010 . ... 4 [10]. , r, , , , n~1. , , -100, , n, 105- 1010 , . ... 30 , , 51010-1011 /2, .. , - [2,3]. 30-100 , , 105-106 ./2 c : (-100) В 50. ...

Еще в разделе: (Показать все результаты (>146) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/nekrasov.pdf
• http://nuclphys.sinp.msu.ru/school/s09/09_22.pdf
• http://nuclphys.sinp.msu.ru/school/s08/s08_18.pdf

... Home > Scientific laboratories > IM . ... The Laboratory of Industrial Mathematics (LIM) headed by Professor V.M. Goloviznin was established in the Faculty of Computational Mathematics and Cybernetics (CMC) of Lomonosov Moscow State University in 2011. ... In the area of energy and space, examples of topical engineering problems LIM is involved in, include the numerical simulation of new-generation atomic plants and computational aeroacoustics. ... Source URL: http://en.cs.msu.ru/laboratories/im . ...

Еще в разделе: (Показать все результаты (>84) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Research Laboratory of Computational Modeling Tools | CMC MSU
• Laboratory of Programming Technologies

BUSINESS ENGLISH LESSON PLAN FOR THE 2nd YEAR STUDENTS: II SEMESTER OF 2012-2013 ACADEMIC YEAR Compiled by: A.S. Matveeva Edited by: L.N. Vygonskaya This business English lesson plan has been designed for students of the Faculty of Mechanics and Mathematics who need to improve their business and social English skills rapidly, effectively and efficiently. ... The subject can be presented orally and students can be asked to contribute any relevant vocabulary they may already have. ... Home Task. ...

Еще в разделе: (Показать все результаты (>20) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section4.pdf

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ?GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY? aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>224) - www.geogr.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>1986) - www.fds-net.ru/ )

• "No network provider accepted the given network path" *DELETED* *DELETED* -
• Интересные ссылки, HOWTO, tips и т.д. постим здесь - Public forum of MSU united
• [News] Научное программное обеспечение - Public forum of MSU united student

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>1296) - www.snto-msu.net/ )

• "No network provider accepted the given network path" *DELETED* *DELETED* -
• Интересные ссылки, HOWTO, tips и т.д. постим здесь - Public forum of MSU united
• [News] Научное программное обеспечение - Public forum of MSU united student

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>19) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]
• extra:model:main [CompHEP]

... Next: COM-port initialization file format Up: Scanning Probe Microscopy Image Previous: Software Installation Contents Index . File is written in text format and consists from one section. ... A record has following format: <voltage>=<temperature>; . ... Example of temperature initialization file listed below. [temperature] -3.00=27.5; -2.67=28.0; -2.33=29.0; -2.00=31.5; -1.67=33.5; -1.33=36.0; -1.00=37.0; -0.67=39.0; -0.33=42.0; 0.00=42.5; 0.33=45.0; 0.67=47.5; 1.00=49.0; 1.33=50.0; 3.00=60.0; . ...

Еще в разделе: (Показать все результаты (>129) - www.spm.genebee.msu.ru/ )

• Curves to section conversion
• COM-port initialization file format
• Fast probe landing and retraction

... We are pleased to inform you that Federation of European Societies of Plant Physiology (FESPP), Russian Academy of Sciences (RAS), Ministry of Education of Russian Federation, Division of Physico-Chemical Biology RAS, Russian Society of Plant Physiologists, Scientific Council of Plant Physiology and Photosynthesis RAS, K.A.Timiryazev Institute of Plant Physiology RAS and Russian Peoples' Friendship University are ... Lev N. Andreev (Moscow, Russia) . ... TUESDAY, OCTOBER, 23rd ...

Еще в разделе: (Показать все результаты (>217) - herba.msu.ru/ )

• Biology and Taxonomy of Green Algae IV
• Handwritings (MW)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... In vitro, the protein S7 of Thermus thermophilus is able to form complexes with both the minimal 16S rRNA fragment and the intercistronic region of the str operon mRNA from E.coli (Kd = 1.4x10-7 M and 1.1x10-7 M respectively). ... The filter binding assay. ... The most striking result of our study is that thermophilic protein S7 binds strongly to the E.coli S12-S7 intercistronic region of str mRNA in vitro, inspite of the lack of the functionally analogous thermophilic extended region. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf

The use of the external module Ab_An.dll Ab_An.dll file is an external module for the Gibbs program, and is designed to calculate the activity coefficients of the components of albite- anortite solid solution. ... A non-ideal model of albite-anortite solid solution, proposed in literature [1], is used in this module. ... Preparation of the System file To be able to use the module Ab_An.dll, you need to include a binary solid solution of albite and anortite into the System file, as you create it. ...

Еще в разделе: (Показать все результаты (>67) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Electrum.doc
• Download Yuri Shvarov's files

... For impatient users: You can download RusTeX in three different ways (Full installation; Selective download; Diskette-ready minimal installation) --- so at least read explanations about these methods before you download something. Please, use "Save link as" (right mouse button) for downloading files, otherwise .arj files and other binary files will be corrupted. ... TeX files are compact and readable in any text viewer: just text and commands for formatting and commands for equations drawing. ...

Еще в разделе: (Показать все результаты (>4) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/texdisk.html

DVM-system of parallel program development . Goals and structure . ... 2.1 C-DVM and Fortran DVM parallel program development . ... Using C-DVM and Fortran-DVM languages a programmer deals with the only version of the program both for sequential and parallel execution. ... These rules are syntactically organized in such a manner that they are "transparent" for standard C and Fortran compilers and doesn't prevent DVM-program execution and debugging on workstations as usual sequential program. ...

Еще в разделе: (Показать все результаты (>104) - sp.cs.msu.ru/ )

• C-DVM language description. Part 1 (1 - 4)
• Fortran DVM - Language for Portable Parallel Programs Development
• DVM-system. Installation guide. Version 3.93