Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>14) - sbmg.geol.msu.ru/ )

• Список элементов HTML

. Lab . Main page News People . ASA . Master . Master net Homepage . Login . SAI MSU . Conference was supported by PLC "MO "OPTIKA" . English Русский . Homepage . Programme . Announcements . Participants . Gallery . SOC & LOC . Contacts . 1st Announcement . International workshop "MASTER Global Robotic Net" devoted to the 10th anniversary of "MASTER" project will take place in Moscow, Russia, August 13-18 2012.

Еще в разделе: (Показать все результаты (>17) - master.sai.msu.ru/ )

. This text will be replaced

Еще в разделе: (Показать все результаты (>7) - polit.msu.ru/ )

• Untitled Document

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD student Ekaterina A. Makeeva . ... One of the winners of 3 rd All-Russian Nanotechnology Internet Olympiad "Nanotechnology - breakthrough to the Future!" (2009), and also places in subject sections: nanochemistry (1st place), nanobiotechnology (1st place), structural materials (2nd place), nanomaterials (3rd place). ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>17) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and

... Ключевые слова: . ... Псково-Печерский монастырь // Журнал Московской Патриархии . ... Аверинцев С.С. ?? ... Ключевые слова: библиография, рецензии ; Библия (переводы) ; Библия: Новый Завет (Евангелия) ; Лезов С.В. Тищенко С.В. Кузнецова В.Н. Аверинцев С.С. [Стихи:] "Рождественская песнь"; "La veille Noel" // Мир Библии . ... Аверинцев С.С. Вслушиваясь в слово: три действия в начальном стихе первого псалма - три ступени зла // Мир Библии . ... Мир Библии . ... Аверинцев С.С. // Мир Библии . ...

Еще в разделе: (Показать все результаты (>22) - www.srcc.msu.ru/ )

... The students of the Faculty of Geography study territorial distribution and spatial development patterns of various natural phenomena as well as social and economic objects. ... The academic program includes courses with lectures, seminars, laboratory and field training in natural sciences and humanities which form 4 blocks: . ... In addition to the field stations of the Faculty, the students have an opportunity to have their field training in scientific institutions and different companies. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ­ Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...

Еще в разделе: (Показать все результаты (>11) - fbm.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>19) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Also, if events can be split up into distinct but overlapping events, how do you approximate the fluences of the individual events? ... In any cases, You can observe new increasing the E>30 MeV fluxes after first event. ... And for that case, what should be difference in fluences, predicted by different models. ... Fig. ... For different SEP model characteristics were used different events sets. 183 were physical events, what were used for development of the regularities, inherent to the SEP events....

Еще в разделе: (Показать все результаты (>8) - srd.sinp.msu.ru/ )

• http://srd.sinp.msu.ru/nymmik/models/bazilevskaya_1.pdf

... Director of the Institute of World Culture . Member of Russian Academy of Sciences . ... Moscow State Lomonosov University (MGU); Institute of Slavic Studies of the Russian Academy of Sciences; Russian State Humanities University (RGGU); University of California, Los Angeles (UCLA), Department of Slavic Languages and Literatures and Indo-European Studies Program. ... Director of the Research Institute of World Culture of the Moscow Lomonosov State University (MGU), 1989-present. ...

Еще в разделе: (Показать все результаты (>16) - imk.msu.ru/ )

... Information for the applicants . ... News . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Faculty of Bioengineering and Bioinformatics, office 433. ... 2016 Faculty of Bioengineering and Bioinformatics, . Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>10) - en.fbb.msu.ru/ )

News from the UNESCO Chair on Global Problems Journal 1/2016 Moscow Russian Federation Lomonosov Moscow State University Faculty of Global Processes Dear colleagues, UNESCO Chairholders and members, international scientists, friends! ... When inaugurating the Chair, the Rector of the University Acad. ... The visit of the UNESCO Director General to the Moscow University represents an important milestone for the development of the multifaceted cooperation between UNESCO and the Russian Federation. ...

Еще в разделе: (Показать все результаты (>3) - unesco.fgp.msu.ru/ )

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia e­mail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the so­called V­ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY Y­MP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>15) - asa.guru.ru/ )

• Буриме от 4 сентября 1997 года
• Буриме от 5 сентября 1997 года
• Буриме от 11 сентября 1997 года

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | ... CDFE: Online Services . ... Coded (machine-retrievable) information . ... DATA . ... This appendix provides a listing of all information-identifier keywords, along with details about their use. ... The general format of the coding string consists of three major fields which may be preceded by a decay flag: ((decay flag)nuclide,half-life,radiation). ... Gives information on references that contain information about the data coded. ...

Еще в разделе: (Показать все результаты (>27) - cdfe.sinp.msu.ru/ )

• Wave function of helium-like ions
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online Services => Nucleus Ground State Parameters

... 9 , 2010 MPI/OpenMP 60 1 2 3 ( PARALLEL) #pragma omp parallel [ [ [, ] ] ...] : default(shared | ... include stdio.h int main () { int n =100000, i; double pi, h, sum , x; h = 1.0 / ( double ) n; sum = 0.0; for (i = 1; i = n; i ++) { x = h * (( double )i - 0.5); sum += (4.0 / (1.0 + x*x)); } pi = h * sum ; printf( pi is approximately %.16f , pi); return 0; } 9 , 2010 MPI / OpenMP 84 1 2 3 OpenMP int main () { int n =100, i; double pi, h, sum , x; h = 1.0 / ( double ) n; ...

Еще в разделе: (Показать все результаты (>8) - angel.cmc.msu.ru/ )

... Et maintenant qu'il faut partir, On a cent mille choses Ю dire, Qui tiennent trop Ю coeur pour si peu de temps., On s'est aimИ comme on se quitte, Tout simplement sans penser Ю demain, A demain qui vient toujours un peu trop vite, Aux adieux qui quelque fois se passent un peu trop bien. ... Allons petite il faut partir, Laisser ici nos souvenirs, On va descendre ensemble si tu veux, Et quand elle va nous voir passer, La patronne du cafИ, Va encore nous dire "Salut les amoureux". ...

Еще в разделе: (Показать все результаты (>10) - optics.sinp.msu.ru/ )

• ABOUT PARTICULARITIES OF INTENSITIES DISTRIBUTION IN CROSS-SECTION OF POWERFUL

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>6) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ
• The Second White Sea Molecular Zoology Summer School ? Биологический факультет

... Hello everybody out there using minix - I'm doing a (free) operating system (just a hobby, won't be big and professional like gnu) for 386(486) AT clones. ... I'd like any feedback on things people like/dislike in minix, as my OS resembles it somewhat (same physical layout of the file-system (due to practical reasons) among other things). ... This implies that I'll get something practical within a few months, and I'd like to know what features most people would want. ...

Еще в разделе: (Показать все результаты (>2) - al.cs.msu.ru/ )

. Click here to start INTAS 95-525 main page.

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• INTAS 95-525 Final Reprort (Short version)