To find out if a command name is located in your command path: which ue /usr/local/bin/ue . This returns the information that the MicroEMACS editor (ue) is available on this system as the file /usr/local/bin/ue . ... To find out which (if any) of several commands are available: which delete talk ps No delete in /usr/local/utils/bin:/bin:/usr/bin: /usr/local/ucb/bin:/usr/local/gnu/bin: /usr/local/public/bin:/usr/bin/X11:. /usr/bin/talk /bin/ps . ...

Еще в разделе: (Показать все результаты (>754) - comet.sai.msu.ru/ )

• Examples of using the man command
• Examples of editing previous command lines
• Examples of previewing the command history

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>110) - neptun.sai.msu.ru/ )

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>906) - uneex.lorien.cs.msu.su/ )

• HelpOnPackageInstaller - UNИX
• HelpOnMoinCommand/ExportDump - UNИX
• Index of /static/AltDocs_informatika2/Book2/ch_11_ruby/09_examples

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>565) - itpm.msu.su/ )

• UUCP-based Transports
• The get Command
• Layout of UUCP Transfers and Remote Execution

Next: Using the CG-editor Up: Java Interface Previous: A generic DII interface . ... The sources of the example are located in the directory mico/tools/ir-browser . ... Once the applet has been loaded, click on the button called Start IR browser . ... If you click on one of these icons using the left mouse button, the IDL source code of that object is shown in the left side of the window. ... click on the withdraw icon with the right mouse button in the browser window to invoke the withdraw() method . ...

Еще в разделе: (Показать все результаты (>620) - rtm-cs.sinp.msu.ru/ )

• Examples
• Qt Toolkit - picture/picture.cpp example file
• Apache module mod_example

Электронная библиотека Попечительского совета . ... Quigley E. - UNIX Shells by Example . ... Название: UNIX Shells by Example . Автор: Quigley E. Аннотация: . The second edition of Unix Shells by Examples shows off basic commands and utilities in the three most popular Unix shells - C, Bourne, and Korn - with side-by-side examples. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8180) - lib.mexmat.ru/ )

• Baird K.C. - Ruby by Example: Concepts and Code :: Электронная библиотека
• Albing C., Vossen JP, Newham C. - bash Cookbook: Solutions and Examples for
• Perry G. - C by Example :: Электронная библиотека попечительского совета

System parameters on Digital UNIX . ... Digital and Cray use the number of bytes as the KIND -parameter. ... LOGICAL Default byte word KIND number = 4 1 4 LOGICAL Default double quad KIND number = 4 8 16 INTEGER int15 int31 int63 KIND number = 2 4 8 digits = 15 31 63 radix = 2 2 2 range = 4 9 18 huge = 32767 2147483647 9223372036854775807 bit_size = 16 32 64 REAL single double quad KIND number = 4 8 16 digits = 24 53 113 maxexponent = 128 1024 16384 minexponent = -125 -1021 -16381 ...

Еще в разделе: (Показать все результаты (>1706) - crydee.sai.msu.ru/ )

• NAG's Fortran 90
• Long description for example showing how structurally overlapping cells are
• A Simple Example With a Single Chirp Component

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>211) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinCommand/ExportDump - UNИX
• Index of /static/AltDocs_informatika2/Book2/ch_11_ruby/09_examples
• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX

... Line: 1 to 1 . ... NOTE : The result from changes script and the topic WebChanges can be different, if the changes file is deleted from a web. ... Note: The manage script can only be called via http POST method for createweb renameweb , and deleteUserAccount . ... Note: The register script can only be called via http POST method, not GET. ... Note: The rename script can only be called via http POST method, not GET. ... Note: The save script can only be called via http POST method, not GET. ...

Еще в разделе: (Показать все результаты (>40615) - dualopt1.cmm.msu.ru/ )

• RegularExpression - TWiki - TWiki

... This section contains notes and hints specific to installing PHP on OpenBSD . ... Then simply find out which flavors you wish to install, and issue the make install command. ... OpenBSD Ports Install Example . cd /usr/ports/www/php4 $ make show VARNAME=FLAVORS (choose which flavors you want from the list) $ env FLAVOR="imap gettext ldap mysql gd" make install $ /usr/local/sbin/php4-enable . There are pre-compiled packages available for your release of OpenBSD . ... Unix/Mac OS X installs . ...

Еще в разделе: (Показать все результаты (>926) - oit.cmc.msu.ru/ )

• Using PHP from the command line
• LDAP functions
• Bzip2 Compression Functions

... CDEPEND } dev-python /pytest[${ PYTHON_USEDEP }] ) RDEPEND= ${ CDEPEND } python_prepare_all() { local PATCHES=( ${FILESDIR} /python3.3-tests.patch ) distutils-r1_python_prepare_all } python_compile_all() { if use examples ; then cd docs / examples || die Couldn't change to docs / examples ${PYTHON} generate.py || die Couldn't generate ...

Еще в разделе: (Показать все результаты (>27171) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/dev-lang/scala/scala-2.10.3-r2.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-lang/scala/scala-2.10.2-r3.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2087.txt

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>6) - storage.bioinf.fbb.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>50) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

You are here: Foswiki > System Web > ReferenceManual > UserDocumentationCategory > RegularExpression (revision 1) E dit A ttach . ... Use of Advanced Regular Expressions . Regular expressions (REs), unlike simple queries, allow you to search for text which matches a particular pattern. ... bug* . ... Second letter is a vowel. ... Be warned, though, that Foswiki only guarantees to support a subset of regular expression syntax, as documented in Foswiki:Development.RegularExpressions . ... System . ...

Еще в разделе: (Показать все результаты (>6767) - wiki.cmc.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• JQueryCycle < System < Foswiki

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>1688) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• examples.zip тАУ Cyclyc Cell Automata

... help . find changesets by author, revision, files, or words in the commit message Template Usage Mercurial allows you to customize output of commands through templates. ... Usage: $ hg log -r1 --style changelog A template is a piece of text, with markup to invoke variable expansion: $ hg log -r1 --template "{node}\n" b56ce7b07c52de7d5fd79fb89701ea538af65746 Strings in curly braces are called keywords. ... The changeset bisection status. bookmarks List of strings. ...

Еще в разделе: (Показать все результаты (>14916) - kodomo.fbb.msu.ru/ )

• Index of /FBB/year_06/term1/Pr_7/Examples
• allpy: ef6692b5ffbc sandbox/ttk.py
• allpy: ef6692b5ffbc

... YUI 2 Examples . ... Contains an un-archived and ready for use copy of YUI 2.8.0 - see http://developer.yahoo.com/yui . ... You do not need to install anything in the browser to use this extension. ... Select "Install". ... See http://foswiki.org/Support/ManuallyInstallingExtensions for more help. ... Copyright : . ... update to v2.8.0 and add v3.0.0 -- Foswiki:Main.AndrewJones . ... http://foswiki.org/Extensions/YahooUserInterfaceContrib . This topic: System > YahooUserInterfaceContrib . ...

Еще в разделе: (Показать все результаты (>2167) - wiki.cs.msu.ru/ )

• FootNotePlugin < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki
• JQueryUITooltip < System < Foswiki

. Example of the Fortran menu . b ,B ,W+ * ****************************************************************** * x: Exit hN: Help (N-menu position) m: MAIN menu * * * * 1: Subprocess 2: IN state * * 3: Model parameters 4: QCD SCALE * * 5: Breit-Wigner 6: Cuts * * 7: Kinematics 8: Regularization * * 9: Vegas 10: Simpson * * 11: Batch 12: View result * ***************************************************************** Type number of menu position and press ENTER:_

Еще в разделе: (Показать все результаты (>952) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce