. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Preface to Research Project "High-Level Decision Making in the Soviet Administrative-Command Economy", . ... This introductory article summarizes the High-Level Soviet Decision Making Project of which the Lazarev and Belova papers are examples. It explains that social scientists must use the modern methods of information economics and the New Economic History to study the Soviet state and party archives using methods of interests to economists and political scientists in general. ...

Еще в разделе: (Показать все результаты (>50) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>84) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• Firefly DOCUMENTATION - command line arguments

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>1904) - www.fds-net.ru/ )

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>151) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>52) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... This is a modification of the original Camera Calibration Toolbox for Matlab by Jean-Yves Bouguet that adds automatic calibration object detection to the functions of the original toolbox. ... The source code can be downloaded lower in this page. v0.31b Download GML Matlab Camera Calibration Toolbox 0.31 11.05.2005 Re-compiled and added correct OpenCV dlls . ... C++ Camera Calibration Toolbox . ...

Еще в разделе: (Показать все результаты (>163) - graphics.cs.msu.ru/ )

• GML MatLab Camera Calibration Toolbox | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>18) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>6) - tex.bog.msu.ru/ )

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ... 8.12.2005, 0:27 . ...

Еще в разделе: (Показать все результаты (>523) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Ассоциации
• Студенческий форум Физфака МГУ > Current Doing
• Студенческий форум Физфака МГУ > Игра "кошка или собака"

... создается некое подобие 3-х мерного пространства Слова показа и и отображены таким же способом. -- param name =example_object_0 value = pltext step =20 font =Verdana:28,3 value =%АППЛЕТ% link = exline :0 color =#009999 param name =example_object_1 value = pltext step =20 shifts=2,2 font =Verdana:28,3 value =%АППЛЕТ% link = ...

Еще в разделе: (Показать все результаты (>15) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer4text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/cursor/cursor1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer1text1.htm

On the 3th of November a report of Drozdov Alexander, manager of Intel Corp. in Russia was presented on the seminar "Mathematics of computers, chips, and electronic circuits". ... Cadence Design Systems, Inc. and Intel, Corp. supports this seminar. ... The main purposes of this seminar are the following: . ... The seminar implements scientific and technical contacts for both domestic and foreign experts in the field of design and use of electronic computing systems. ... Seminar organization: . ...

Еще в разделе: (Показать все результаты (>39) - www.intsys.msu.ru/ )

• Intelligent Systems :: Research :: :: Articles

DVM-system of parallel program development . Installation guide . ... 1.2 Installation of binary version of DVM-system . ... DVM-system is delivered in two variants: as source files (file dvmNNN.tar.gz ) and as binary version - executable programs and libraries (file dvmNNN_win.zip ). ... If you intend to work with DVM-system on single computer (development and debugging of DVM-programs), you can use implementation MPICHWIN (file mpichwin.zip ) from our site ( www.keldysh.ru/dvm ). ...

Еще в разделе: (Показать все результаты (>153) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.95
• Fortran DVM language description
• DVM-system. Installation guide. Version 3.60

... Mathematical Treatment of Exhaust Systems with Acoustic Properties Using Mathlie I. Algorithms . ... The first part of the two talks is concerned with   algorithms applied to examples origin from an   exhaust system. ... The model equations are determined   by conservation of mass, momentum and energy. In addition there exists an equation of state   for the ideal gas system. ... Applying computer algebra to   these model equations, we demonstrate that   solutions can be derived. ...

Еще в разделе: (Показать все результаты (>49) - acs366.phys.msu.su/ )

Astronomy Picture of the Day . NGC 1 and NGC 2 . ... 19.08.2005 . ... Credit: R Jay GaBany ( Cosmotography.com ) Explanation: Beautiful nebulae , clusters , and galaxies that grace planet Earth's night sky are often known by their New General Catalog designation or NGC number . ... NASA Web Site Statements, Warnings, and Disclaimers . NASA Official: Jay Norris. ... Publications with keywords: NGC catalog - spiral galaxy . Publications with words: NGC catalog - spiral galaxy . ...

Еще в разделе: (Показать все результаты (>3027) - www.astronet.ru/ )

• Flying over Planet Earth
• Journal "Peremennye Zvezdy"
• Астронет > NGC 1 and NGC 2

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>127) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee service

Thursday, June 24th, 2010 . ... Wednesday, June 16th, 2010 . На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for June, 2010. ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>4) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>48) - imaging.cmc.msu.ru/ )

ChangeLog for snakes # # Generated by Trac 0.12.5 # 04/11/16 22:55:00 Mon, 20 Dec 2010 14:01:39 GMT Daniil Alexeyevsky me.dendik@тАж [134:8e75e931bfd2] * snakes / example.snake ( modified ) example.snake : better rules for chasing enemy tail Mon, 20 Dec 2010 11:57:44 GMT Daniil Alexeyevsky me.dendik@тАж [121:06e4b4ea7596] * snakes / example.snake ( modified ) * ...

Еще в разделе: (Показать все результаты (>383) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=360c297c05f3577ca730ecaf86131163456f6b73&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=138%3A416418c9aaef&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/snakes?format=changelog&rev=416418c9aaefbd75f3451a63f12d0ab8af3b89f3&limit=100&mode=stop_on_copy