... Peptide Sequence Databases . ... BLAST searches can be limited to the results of an Entrez query against the database chosen. ... For example: Mus musculus[Organism] For help in constructing Entrez queries please see the " Writing Advanced Search Statements " section of the Entrez Help document. ... Only following combinations of the Matrix, Open & Extended Gaps are available: Recomended combinations are colored. ... Gap . ... Standard BLAST alignment in pairs of query sequence and database match. ...

Еще в разделе: (Показать все результаты (>214) - www.genebee.msu.ru/ )

• BLAST Basic Overview
• Databases

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>38) - mouse.genebee.msu.ru/ )

... Protein sequences . ... European ribosomal RNA database . ... Thermodynamic database for protein-nucleic acids interactions (Japan) . ... Families of structurally similar proteins . ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering complete protein sequences. ... Database issues of NAR: vol. 31 (2003) , vol. 32 (2004) , vol. 33 (2005) , vol. 34 (2006) , vol. 35 (2007) , vol. ...

Еще в разделе: (Показать все результаты (>1516) - monkey.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysus
• About COGs
• ETS sequence conservation

Berkeley Database . The Berkeley Database (Berkeley DB) is a programmatic toolkit that provides embedded database support for both traditional and client/server applications. ... DB is available for a wide variety of UNIX platforms as well as Windows NT and Windows '95 (MSVC 4, 5 and 6). ... Available Binary Packages: . ... None . ... User Comments: . ... SAL Home | Database Systems | Utilities Other DBMS . Comments? SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>4545) - www.sai.msu.su/ )

• Sternberg Astronomical Institute
• SAL- Other Scientific Fields - Chemistry, Biology Related - HMMER
• SAL- Database Systems - Relational DBMS - Recital

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6992) - mouse.belozersky.msu.ru/ )

FASTA /TFASTA/FASTX/TFASTXv3(1) FASTA /TFASTA/FASTX/TFASTXv3(1) NAME fasta3, fasta3_t - scan a protein or DNA sequence library for similar sequences tfasta3, tfasta3_t - compare a protein sequence to a DNA sequence library , translating the DNA sequence library `on-the-fly'. fastx3, fastx3_t - compare a DNA sequence to a protein sequence ... REF_URL the format string used to define the option to lookup the library sequence in entrez, or some other database. ...

Еще в разделе: (Показать все результаты (>5333) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/formatrpsdb.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/megablast.html
• http://kodomo.cmm.msu.ru/~molotok/Term3/blastp1

Электронная библиотека Попечительского совета . ... Bishop M.J. - Genetic Databases (Biological Techniques Series) . ... Название: Genetic Databases (Biological Techniques Series) . Автор: Bishop M.J. Аннотация: . ... The book describes the different types of databases, how to use a specific database to find a sequence that you need, and how to analyze the data to compare it with your own work. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11822) - lib.mexmat.ru/ )

• Brown S.M. - Bioinformatics: A Biologist's Guide to Biocomputing and the
• Attwood T.K., Parry-Smith D.J. - Introduction to bioinformatics :: Электронная
• Morales T., Lorentz D. - Oracle9i Database Reference (Part No. A90190-02) ::

You are here: Iono Group / SAMNET / Magnetometers database . More information about each magnetometer is available by clicking on the station link. ... IMAGE . Alta, Norway . ... Andenes, Norway . ... SAMNET . ... BGS station, but archived at 1s resolution by SAMNET . ... Hankasalmi, Finland . ... IMAGE station, but archived at 1s resolution by SAMNET . ... 1s resolution data is available from the SAMNET data archive . ... This list can be filtered to show just SAMNET magnetometers . ...

Еще в разделе: (Показать все результаты (>74) - www.kosmofizika.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>4917) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Relational ENSDF

. Laboratory for Neurophysiology and Neuro-Computer Interfaces . M.V.Lomonosov Moscow State University . Faculty of Biology . EEG Records Databases . EEG Databases available: . EEG of healthy adolescents and adolescents with symptoms of schizophrenia . Event-related potentials in a moving matrix modification of the P300 BCI . Other databases will be available soon.

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

• EEG Database - Schizophrenia

. Maximum RPM: Taking the Red Hat Package Manager to the Limit . Prev . Appendix C. Concise RPM Command Reference . Next . RPM's rebuild database mode is used to rebuild an RPM database: . Format: rpm --rebuilddb <options> . Only the global options may be used. Prev . Home . Next . Initalize Database Mode . Up . Available Tags For --queryformat

Еще в разделе: (Показать все результаты (>403) - uneex.lorien.cs.msu.su/ )

• mod_auth_dbm - Apache HTTP Server
• Initalize Database Mode
• Frequently Asked Questions - Apache HTTP Server

... Data . ... Solar flare database (RU) . ... CH area is measured in relative units, where total area of the Sun equals one unit. Minimal significant area is 0.002 relative units. Average intensity is calculated after filtering and histogram scaling into the range from 0 to 255. ... Coronal holes count . Total area of coronal holes . Average intensity over coronal holes . Average intensity over image . ...

Еще в разделе: (Показать все результаты (>68) - smdc.sinp.msu.ru/ )

• Coronas-I - Space monitoring data center
• COHO project - Space monitoring data center
• Space monitoring data center

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>36422) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• allpy: a1307c0bb030 test/usecase1.py

BCVISS: a web application for analyzing mixed 16S rRNA gene chromatograms A.V. Popova, L. S. Karan, S. N. Gavrilov, A. D. Neverov Central Research Institute of Epidemiology, Moscow, Russia, weidewind@gmail.com Direct sequencing of 16S rRNA gene is commonly used in diagnostics of septic diseases for identification of bacterial pathogens. ... We also reanalyzed two gastric mucosa samples from our previous work [1] that were characterized by cloning and sequencing of PCR amplified 16S gene. ...

Еще в разделе: (Показать все результаты (>295) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/35.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/222.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/178.pdf

... This document provides a set of guidelines for the administration and operation of public Network Information Center (NIC) databases. The purpose is to formalize procedures for the responsible handling of the personal and organizational information maintained by NICs in publically accessible databases, and to improve the accuracy and accessibility of such data where appropriate. ... The first part contains recommendations for preventing unauthorized disclosure of information in NIC databases. ...

Еще в разделе: (Показать все результаты (>18757) - mirror.msu.net/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>10) - npidb.belozersky.msu.ru/ )

• NPIDB: About Us

Data are provided with the intent that they are readily available for personal and public non-commercial use and may be reproduced, in part or in whole and by any means, without charge or further permission from IWSG. However, proper reference to contributors of original data to the database must be provided in all cases, and due diligence should be exercised in ensuring the accuracy of the materials reproduced . ... Bird species report. In : ARCTIC BIRDS breeding conditions survey . ...

Еще в разделе: (Показать все результаты (>3) - arctic.ss.msu.ru/ )

• BIRDS SPECIES DATABASE of the Arctic Birds Breeding Conditions Survey

. Главная . Лаборатория математических методов обработки изображений . Кафедра математической физики . факультета Вычислительной математики и кибернетики . МГУ имени М.В.Ломоносова . Главная . The final version of the developed ringing database is available here: . ringingdb_130604.zip (796M) . The ringing extension of TID 2013 database: . ringingtid.zip (???M) .

Еще в разделе: (Показать все результаты (>116) - imaging.cmc.msu.ru/ )

. PHP Manual . Prev . Next . (PHP 4 >= 4.0.6) fbsql_database -- Get or set the database name used with a connection . string fbsql_database ( resource link_identifier [, string database]) . Warning . This function is currently not documented, only the argument list is available. Prev . Home . Next . fbsql_warnings . Up . fbsql_get_autostart_info

Еще в разделе: (Показать все результаты (>870) - oit.cmc.msu.ru/ )

• Database issues
• FrontBase Functions
• Database (dbm-style) abstraction layer functions

... DEVISER . loosely-coupled Datalog EValuator Integrated with SchemE . ... Chair of System Programming . ... Documentation . ... DEVISER - is research project in progress, open-source system that can evaluate programs of language of logic programming of databases, Datalog. DEVISER involves the ideas of logic programming, database theory and functional programming. ... Nov 24 2006: DEVISER 1.2.1 is available: deviser-1.2.1.tar.gz . ... May 24 2004: DEVISER 1.2.0 is available: dtlog-1.2.0.tar.gz . ...

Еще в разделе: (Показать все результаты (>103) - sp.cs.msu.ru/ )