Электронная библиотека Попечительского совета . ... Siau K. (ed.) - Advanced Topics in Database Research (vol. ... Название: Advanced Topics in Database Research (vol. ... Автор: Siau K. (ed.) . ... Advanced Topics in Database Research, Volume 5 presents the latest research ideas and topics on database systems and applications, and provides insights into important developments in the field of database and database management. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9832) - lib.mexmat.ru/ )

• Siau K. - Advanced Topics in Database Research (vol. 3) :: Электронная
• Siau K. - Advanced Topics in Database Research (vol. 4) :: Электронная
• Piattini M., Diaz O. - Advanced Database Technology and Design :: Электронная

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Springer-Verlag . Местоположение издательства: Heidelberg, Germany . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены. обратная связь . Создать

Еще в разделе: (Показать все результаты (>1604) - istina.msu.ru/ )

... Relational DBMS (RDBMS) is still the most popular database management system on the market. Most large-scale commerical applications are built upon relational database systems, typically in Client/Server models. Search SAL: . ... Leap -- a relational database management system and relational algebra processor. ... RDBMS Linter SQL -- a relational database management system with SQL-92 implementation. ... YARD-SQL -- relational database system for Unix including ESQLC, JDBC and ODBC. ...

Еще в разделе: (Показать все результаты (>914) - www.sai.msu.su/ )

• SAL- Database Systems - Relational DBMS - ADABAS D
• WWW gateway to SAI databases
• SAL- Database Systems - Utilities Other DBMS - c-tree Plus

. Please use the reference to MASTER DataBase as Lipunov et al., 2010, MASTER Robotic Net, Advances in Astronomy, vol. 2010, pp. 1-7 . - days . MASTER , 2002-2016

Еще в разделе: (Показать все результаты (>3) - apollo.sai.msu.ru/ )

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6984) - mouse.belozersky.msu.ru/ )

... Protein sequences . ... European ribosomal RNA database . ... Thermodynamic database for protein-nucleic acids interactions (Japan) . ... Families of structurally similar proteins . ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering complete protein sequences. ... Database issues of NAR: vol. 31 (2003) , vol. 32 (2004) , vol. 33 (2005) , vol. 34 (2006) , vol. 35 (2007) , vol. ...

Еще в разделе: (Показать все результаты (>766) - monkey.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysus
• About COGs

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• XAFS Publication Database search form

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | ... ONLINE SERVICES. ... G E N P D T H3 A HE3 HE4 LI6 C12 O16 O17 O18 S32 AR40 TI48 BRST BRST-POL MON MON-POL POL . ... CDFE Head : Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>4912) - cdfe.sinp.msu.ru/ )

• Wave Function Value Database
• CDFE => Online Services => Relational ENSDF

... Peptide Sequence Databases . ... BLAST searches can be limited to the results of an Entrez query against the database chosen. ... For example: Mus musculus[Organism] For help in constructing Entrez queries please see the " Writing Advanced Search Statements " section of the Entrez Help document. ... Only following combinations of the Matrix, Open & Extended Gaps are available: Recomended combinations are colored. ... Gap . ... Standard BLAST alignment in pairs of query sequence and database match. ...

Еще в разделе: (Показать все результаты (>193) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services .
• GeneBee BLAST 2.2.8 Services

Related papers . ... N. N. Nepeyvoda, Logics and programming's styles (Russian, PDF). ... Abstract. ... D. Levshin Semantic Web and PostgreSQL Integration Algorithms (Russian, PDF). ... We consider Semantic Web and PostrgreSQL DBMS integration. Analysis of known systems for using databases with Semantic Web is performed, PostgreSQL features that can be useful for integration implementation are emphasized, integration methods and algorithms are proposed, and one of these algorithms is implemented. ...

Еще в разделе: (Показать все результаты (>69) - sp.cs.msu.ru/ )

... Alexey D. Neverov . ... Department of Bioengineering and Bioinformatics, Moscow State University. State Scientific Center GosNIIGenetika. ... EDAS human . EDAS mouse . EDAS dog (not availible now) . EDAS rat (not availible now) . To navigate this site please install the latest version of Macromedia Flash Player for Windows or for Linux . If you do not wish to install Flash you could use text pages with less functionality. ...

Еще в разделе: (Показать все результаты (>6) - edas2.bioinf.fbb.msu.ru/ )

• Alternative Splicing DataBase.
• EDAS (human) - Alternative Splicing DataBase.
• EDAS (mouse) - Alternative Splicing DataBase.

. ЭКОЛОГИЧЕСКАЯ ИНФОРМАЦИЯ . WEB- ориентированная библиографическая база данных .

Еще в разделе: (Показать все результаты (>5) - ecoinformatica.srcc.msu.ru/ )

About BAFIZ . ... BAFIZ is a program devoted to the development of a distributed network of the knowledge and data bases for research of fundamental properties of the matter and applied nuclear physics. The project sponsored by Russian Foundation of Basic Research , RFBR reference number is 95-07-19502. ... This Page is developed at Laboratory of Computational Mathematics, . ... Last updated on 2 September 1999 . Copyright 1999 Laboratory of Computational Mathematics (DRCM) ...

Еще в разделе: (Показать все результаты (>23) - dbserv.sinp.msu.ru/ )

BLASTP 2.2.25+ # Query: AAGY02000001_1 [35 - 310] Streptococcus pneumoniae TIGR4 ctg00822, whole genome shotgun sequence.. Database: bacsu # 0 hits found # BLASTP 2.2.25+ # Query: AAGY02000001_2 [196 - 540] Streptococcus pneumoniae TIGR4 ctg00822, whole genome shotgun sequence.. Database: bacsu # 0 hits found # BLASTP 2.2.25+ # Query: AAGY02000001_3 [596 - 847] Streptococcus pneumoniae TIGR4 ctg00822, whole genome shotgun sequence.. ...

Еще в разделе: (Показать все результаты (>4112) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~jimsonweed89/files/aal.out
• http://kodomo.cmm.msu.ru/~christablel/term3/blastn.1fasta
• http://kodomo.cmm.msu.ru/~kut/term3/files/bnresult.txt

... These functions build the foundation for accessing Berkeley DB style databases. This is a general abstraction layer for several file-based databases. As such, functionality is limited to a common subset of features supported by modern databases such as Sleepycat Software's DB2 . ... When invoking the dba_open() or dba_popen() functions, one of the following handler names must be supplied as an argument. ... dbm . Dbm is the oldest (original) type of Berkeley DB style databases. ... db2 . ...

Еще в разделе: (Показать все результаты (>337) - oit.cmc.msu.ru/ )

• dba_nextkey
• fbsql_database_password
• yaz_database

. Maximum RPM: Taking the Red Hat Package Manager to the Limit . Prev . Appendix C. Concise RPM Command Reference . Next . RPM's rebuild database mode is used to rebuild an RPM database: . Format: rpm --rebuilddb <options> . Only the global options may be used. Prev . Home . Next . Initalize Database Mode . Up . Available Tags For --queryformat

Еще в разделе: (Показать все результаты (>225) - uneex.lorien.cs.msu.su/ )

• Initalize Database Mode
• htdbm - Manipulate DBM password databases - Apache HTTP Server
• mod_auth_dbm - Apache HTTP Server

Bird Species Database (BSD) is being compiled in a framework of the Arctic Birds Breeding Conditions Survey (ABBCS) of the International Wader Study Group (IWSG). BSD aims at providing information on distribution, numbers and breeding status of birds in the Arctic, with the focus on last-breaking and, thus usually unpublished information. The primary source of data is questionnaires filled in by contributors to the ABBCS, while data from literature are being added occasionally. ... breeding . ...

Еще в разделе: (Показать все результаты (>3) - arctic.ss.msu.ru/ )

• BIRDS SPECIES DATABASE of the Arctic Birds Breeding Conditions Survey

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>22) - seac47-2.phys.msu.ru/ )

... The RADEN data bank produced at the Department of Chemistry of Moscow State University is designed as well to accumulate published information on radiative parameters of diatomic molecules, as to analyse it and recommend the more reliable values. ... electronic transition moments D ( R ); . ... dipole moments, . ... FACTUAL RECOMMENDED DATABASE contains now the ab initio and experimental electronic transition moments for more than 250 band systems which belong to more than 100 diatomic molecules. ...

Еще в разделе: (Показать все результаты (>35) - electr003.chem.msu.ru/ )

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>26232) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• allpy: a1307c0bb030 test/usecase2.py