Homepage: http://users.tpg.com.au/j_birch/plugins/superfish/ . ... Superfish is an enhanced Suckerfish-style menu jQuery plugin that takes an existing pure CSS drop-down menu (so it degrades gracefully without JavaScript). ... The class added is sfHover by default but can be changed via the options object, . ... Supports the hoverIntent plugin. ... Requires Foswiki:Extensions.TreePlugin . ... menu item . ... subitem 1a . ... short . ... This topic: System > JQueryPlugin > JQuerySuperfish . ...

Еще в разделе: (Показать все результаты (>41856) - wiki.cmc.msu.ru/ )

• VarADDTOZONE < System < Foswiki

... Working in TWiki is as easy as typing in text - exactly like email. ... SpreadSheetPlugin (any TWiki, $Rev: 18078 (02 Sep 2009) $) : Add spreadsheet calculation like "$SUM( $ABOVE() )" to TWiki tables and other topic text . BreadCrumbsPlugin (v2.01, $Rev: 17469 (12 Dec 2008) $) : A flexible way to display breadcrumbs navigation . ... InterwikiPlugin (28 Feb 2009, $Rev: 14913 (17 Sep 2007) $) : Link ExternalSite:Page text to external sites based on aliases defined in a rules topic . ...

Еще в разделе: (Показать все результаты (>44198) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (25 vs. 26) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• TextFormattingRules - TWiki - TWiki

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... Adding Dependency Information to a Package . ... When a package is built by RPM, if any file in the package's %files list is a shared library, the library's soname is automatically added to the list of capabilities the package provides. ... RPM uses two scripts to handle automatic dependency processing. ... Since the libc package includes, among others, the shared library /lib/libc.so.5.3.12 , RPM would obtain its soname. ...

Еще в разделе: (Показать все результаты (>862) - uneex.lorien.cs.msu.su/ )

• HelpOnPackageInstaller - UNИX
• HelpOnImages - UNИX
• HelpOnMoinCommand/ExportDump - UNИX

... PHP 4 >= 4.0.2) wordwrap -- Wraps a string to a given number of characters using a string break character. string wordwrap ( string str [, int width [, string break [, int cut]]]) . Returns a string with str wrapped at the column number specified by the (optional) width parameter. ... text = "The quick brown fox jumped over the lazy dog."; $newtext = wordwrap( $text, 20 ); echo "$newtext\n"; . ... text = "A very long woooooooooooord."; $newtext = wordwrap( $text, 8, "\n", 1); echo "$newtext\n"; . ...

Еще в разделе: (Показать все результаты (>1023) - oit.cmc.msu.ru/ )

• Variables from outside PHP
• tmpfile
• Constructors

. To set the wrapmargin: :set wm=5 . This sets the wrapmargin to five characters. In insert mode, text will automatically wrap to a new line when the cursor is five characters from the right edge of the screen. To display line numbers: :set number . This causes vi to display a line number (starting at 1) at the start of every line of text .

Еще в разделе: (Показать все результаты (>513) - comet.sai.msu.ru/ )

• Examples of reading other mail files
• Example of customising the less command
• Saving mail in folders

This diagram illustrates a frame-like layout with 'position: fixed'. The illustration shows a four-panel frameset. The top panel ("header") covers the entire width of the frameset and takes up 15% of the vertical space. ... To the right of the sidebar and below the header is the "main" area, whose dimensions are computed based on remaining available space. Finally, at the bottom, the "footer" area is 100px high and covers the entire width of the frameset. ...

Еще в разделе: (Показать все результаты (>1264) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Keyword arguments and default arguments
• A Simple Example With a Single Chirp Component

Электронная библиотека Попечительского совета . ... Quigley E. - JavaScript by Example . ... Название: JavaScript by Example . Автор: Quigley E. Аннотация: . ... By best-selling author Ellie Quigley, Silicon Valley's top scripting language instructor!! ... In JavaScript by Example, Ellie Quigley teaches JavaScript using the same proven approach that's made her the world's favorite scripting author and instructor. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7956) - lib.mexmat.ru/ )

• Goodman D. - JavaScript examples bible :: Электронная библиотека
• Koch P.- P. - ppk on JavaScript: Modern, Accessible, Unobtrusive JavaScript
• Marchal B. - XML by Example :: Электронная библиотека попечительского совета

Next: Using a Servant Manager Up: POA Previous: Policies . As an example, let's write a simple POA-based server. ... Next, we rewrite the server. 1: // file server.cc 2: 3: #include hello.h 4: 5: class HelloWorld_impl : virtual public POA _ HelloWorld 6: { 7: public: 8: void hello() { printf ( Hello World!\n ); }; 9: }; 10: 11: 12: int main( int argc, char *argv[] ) 13: { 14: CORBA:: ORB _var orb = CORBA:: ORB _init (argc, argv, mico-local- orb ); 15: CORBA:: Object _var poaobj = ...

Еще в разделе: (Показать все результаты (>591) - rtm-cs.sinp.msu.ru/ )

• Examples
• Qt Shared Classes
• Apache module mod_example

On this page: . ... Events . ... A call to $(foo).dialog() will initialize a dialog instance and will auto-open the dialog by default. If you want to reuse a dialog, the easiest way is to disable the "auto-open" option with: $(foo).dialog({ autoOpen: false }) and open it with $(foo).dialog('open') . ... This will initialize the following css classes to build the dialog widgets: . ... This event is triggered when dialog is created . ... This topic: System > JQueryPlugin > JQueryUIDialog . ...

Еще в разделе: (Показать все результаты (>22044) - wiki.cs.msu.ru/ )

• WebHome < System < Foswiki
• SafeWikiPlugin < System < Foswiki
• YahooUserInterfaceContrib < System < Foswiki

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>209) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnMoinCommand/ExportDump - UNИX
• HelpOnLinking - UNИX

... Client/Server Examples . ... Up: Client/Server Examples Next: Ocean/Atmosphere - Relies on Name Publishing Previous: Client/Server Examples . The following example shows the simplest way to use the client/server interface. ... Up: Client/Server Examples Next: Simple Client-Server Example. ... MPI_Open_port(MPI_INFO_NULL, port_name); MPI_Publish_name("ocean", MPI_INFO_NULL, port_name); . ... MPI_Comm_connect( port_name, MPI_INFO_NULL, 0, MPI_COMM_WORLD, &server ); . ... Центры . ...

Еще в разделе: (Показать все результаты (>414) - www.parallel.ru/ )

• MPE | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Caches a static list of files in memory . ... file_cache_module . ... mod_file_cache caches a list of statically configured files via MMapFile or CacheFile directives in the main server configuration. ... The CacheFile directive of mod_file_cache opens an active handle or file descriptor to the file (or files) listed in the configuration directive and places these open file handles in the cache. ...

Еще в разделе: (Показать все результаты (>481) - itpm.msu.su/ )

• mod_example - Apache HTTP Server
• mod_dav - Apache HTTP Server
• mod_setenvif - Apache HTTP Server

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>23) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE provides the major photonuclear databases. Online Services.

... Currently if we insert or update a line in the ts_readme table, we have to remember to also update the ts_vec column. ... CREATE TRIGGER ts_readme_ts_vec_update BEFORE UPDATE OR INSERT ON ts_readme FOR EACH ROW EXECUTE PROCEDURE tsearch2(ts_vec, line); INSERT INTO ts_readme (line_number, line) VALUES (211, 'Adding another line to tsearch readme file.' SELECT * FROM ts_readme WHERE line_number = 211; -[ RECORD 1 ]--------------------------------------------------------- line_number | 211 line | ...

Еще в разделе: (Показать все результаты (>1652) - www.sai.msu.su/ )

• GIMP animations: merge-anim examples
• The Name of the Plug-In: Example Images
• GIMP animations: merge-anim example 4

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>101) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Source Re-organisation
• Apache's Handler Use

... About Trac . Wiki . ... wiki: WikiFormatting . ... Trac has a built in small and powerful wiki rendering engine. ... Display: . ... and `...` commands not only select a monospace font, but also treat their content as verbatim text, meaning that no further wiki processing is done on this text. ! ... Example: * Item 1 * Item 1.1 * Item 1.1.1 * Item 1.1.2 * Item 1.1.3 * Item 1.2 * Item 2 1. ... Cell 1|| ... Image(wiki:WikiFormatting:picture.gif)]] (referring to attachment on another page) . ...

Еще в разделе: (Показать все результаты (>1604) - kodomo.cmm.msu.ru/ )

• TracWorkflow тАУ Tanchiki
• WikiProcessors тАУ Tanchiki
• example.snake in snakes тАУ Python Battle

... About lab . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. Filter automatically determines the blockiness's strength on the frame and in the certain part of it, preserving the maximum of details. ...

Еще в разделе: (Показать все результаты (>199) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Лаборатория компьютерной графики и
• Smart removal of blocking effects from video | Лаборатория компьютерной графики
• Smart removal of blocking effects from video | Graphics and Media Lab

... fc3:dokuwiki:example ]] . THEP . ... Note: The Dokuwiki to be upgraded is in /var/www/wiki on the machine called mybox, I am logged in as root, and Dokuwiki version 2005-07-01 has been extracted to ~/dokuwiki/wiki/ . ... Create a temp directory mybox:/var/www# mkdir newwiki . ... Copy the changes.log file to the new location mybox:/var/www/newwiki# cp .. / wiki / changes.log data / . Copy standard data to the new location mybox:/var/www/newwiki# cp -R .. / wiki / data /* data / pages / . ...

Еще в разделе: (Показать все результаты (>1154) - theory.sinp.msu.ru/ )

• Tensor ghost.
• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )