... We compared the possibilities of applying of two different kinetic models for the determination of reaction rate constants in micelles. ... The pseudophase model can be used to estimate the reaction kinetics in micelles only in cases b and c. If the decay deviates insignificantly from an exponential decay, the accurate determination of the rate constants from decay data will be virtually impossible by any of the discussed kinetic models. ...

Еще в разделе: (Показать все результаты (>1516) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 46, No. 4, P. 203 (2005)
• Moscow University Chemistry Bulletin Vol. 53, No. 1, P. 50 (2012)
• Moscow University Chemistry Bulletin Vol. 50, No. 6, P. 411 (2009)

Numerical Simulation of Fluid Flow in a Fractured Porous Medium / Khodos O.A. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>557) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

PHP Manual . ... int dbx_compare ( array row_a, array row_b, string columnname_or_index [, int flags]) . ... This function is EXPERIMENTAL . ... Returns 0 if row_a[$columnname_or_index] is equal to row_b[$columnname_or_index], 1 if it is greater and -1 if it is smaller (or vice versa if the DBX_CMP_DESC flag is set). The flags can be set to specify comparison direction (whether sorting is ascending or descending) and comparison type (force string or numeric compare by converting the data). ...

Еще в разделе: (Показать все результаты (>617) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

Alternating direction implicit numerical method for 3D fluid flow simulation using GPU" . Berezin S.B., Paskonov V.M., Sakharnykh N.A. An efficient GPU implementation of the alternating direction implicit (ADI) numerical method in 3D domains is proposed. ... Keywords: alternating direction implicit method, parallel computing, GPU, Navier-Stokes equations . PostScript (in Russian) (892KB) . PDF (in Russian) (205KB) . PostScript. zip (in Russian) (394KB) . ...

Еще в разделе: (Показать все результаты (>679) - num-meth.srcc.msu.ru/ )

• "Determination of guided modes in multilayer dielectric waveguides"
• "Discretization of Navier-Stokes equations on moving unstructured meshes"
• "Numerical integration of Poisson's equation using a graphics processing unit

Электронная библиотека Попечительского совета . ... Lewis M. - Comparing, Designing, and Deploying VPHs . ... Название: Comparing, Designing, and Deploying VPHs . Автор: Lewis M. Аннотация: . ... Comparing, Designing, and Deploying VPNs will bring together many of the most popular VPN technologies for convenient reference. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11856) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement
• Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R ::
• Moskowitz C.S. - Quantifying and comparing the predictive accuracy of

... 2011 February 22 . Star Size Comparisons . ... Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... About APOD | ...

Еще в разделе: (Показать все результаты (>5508) - www.sai.msu.su/ )

• APOD: 2013 June 6 - Star Size Comparisons
• SAL- Other Scientific Fields - Electrical Related Software - DAI Comparescan
• Supernovae Charts.

... 21.02.2011 . ... Credit Copyright: morn1415 (YouTube) Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... Publications with keywords: star - planet . ...

Еще в разделе: (Показать все результаты (>5950) - www.astronet.ru/ )

• Астронет > Star Size Comparisons
• Finding Dark Matter
• Journal "Peremennye Zvezdy"

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>21) - site2010.sai.msu.ru/ )

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>262) - rtm-cs.sinp.msu.ru/ )

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>58) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>258) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/50.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>176) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>75) - www.prof.msu.ru/ )

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Compare Best Deals . ... Safety is a very important part of candle making. <a href=http://www.ign.com/blogs/surpdistatam/2013/06/12/learn- to-read-guitar-sheet-music-like-a-pro-8-week-course/>Lear n To Read Guitar Sheet Music Like A Pro - 8 Week Course</a> . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2445) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Prices
• Экологический Форум - Фундаментальная Экология: Price Compare Website
• Экологический Форум - Фундаментальная Экология: materials compared for yuan;

. Album : asv-album :: Travels to distant places and countries :: 1997/08 Kyoto, Nara (Japan) :: 20/08 Nijo castle (ancient shogun palace). Assembly opening. Maiko . Up . Nijo castle, Shogun palace. The main building. Comparing to temples and shrines, royal architecture looks modest. Next >> . Photo album generated by album generator from Marginal Hacks by David Madison on Tue Jun 23 14:46:11 2015 .

Еще в разделе: (Показать все результаты (>917) - crydee.sai.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . ... Войти в систему . ... Создать обращение в службу поддержки пользователей . ...

Еще в разделе: (Показать все результаты (>3927) - istina.msu.ru/ )

• Kaiser J.W. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Aoki Y. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars,   total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>405) - xray.sai.msu.ru/ )

• Introduction
• Basic Observational Data for Determination of f(q) and
• Discussion and conclusions

... MPI_Group_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>257) - www.parallel.ru/ )

• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по
• C++ Bindings for Groups, Contexts, and Communicators | PARALLEL.RU -

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Mar-22 18:15:34 . 0.8K . application/octet-stream . Manifest . 2016-Mar-22 18:15:34 . 2.2K . application/octet-stream . metadata.xml . 2016-Feb-05 23:59:02 . 0.2K . text/xml . ppx_compare-113.24.00.ebuild . 2016-Feb-05 23:59:02 . 0.8K . text/plain . ppx_compare-113.33.00.ebuild . 2016-Mar-22 13:07:03 . 0.8K . text/plain . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>14284) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-perl/Struct-Compare/
• Index of /pub/gentoo-portage/dev-perl/Array-Compare/
• Index of /pub/gentoo-portage/dev-perl/Data-Compare/

FASTA /TFASTA/FASTX/TFASTXv3(1) FASTA /TFASTA/FASTX/TFASTXv3(1) NAME fasta3, fasta3_t - scan a protein or DNA sequence library for similar sequences tfasta3, tfasta3_t - compare a protein sequence to a DNA sequence library , translating the DNA sequence library `on-the-fly'. fastx3, fastx3_t - compare a DNA sequence to a protein sequence ... REF_URL the format string used to define the option to lookup the library sequence in entrez, or some other database. ...

Еще в разделе: (Показать все результаты (>420) - kodomo.cmm.msu.ru/ )

• compare
• Term4