... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>250) - uneex.mithril.cs.msu.su/ )

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>1397) - crydee.sai.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>2630) - uneex.lorien.cs.msu.su/ )

• HelpOnLinking - UNИX
• mod_file_cache - Apache HTTP Server
• mod_example - Apache HTTP Server

Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>6982) - mouse.belozersky.msu.ru/ )

• Alignment example
• Geometrical core

... MLNKLSAEFFGTFWLVFGGCGSAILAA--AFP------ELGIGFLGVALAF . ... SSLAPAG-FAPIAIGFGLTLIHLVSIPVTNTWVNPARSTG--VA--LF-----ADTAAL . ... MGRKLLAEFFGTFWLVFGGCGSAVFAA--AFP------ELGIGFTGVALAF . ... HGRVPAG-FAPIAIGLALTLIHLISIPVTNTSVNPARSTG--QA--LF-----VGGWAL . ... MSQT---STLKGQCIAEFLGTGLLIFFGVGCVA--ALKVAG------ASFGQWEISVI-W . ... ANQFTEG-LNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFL---PIPGKGSS . ... YPHFKATED-----QG-----AKLAVFSTDP-AIKHLPANFFSEVLGTFVLVLGILAIG- . ... MIDTSLATQFLGEVIGTAILIILGAGVVAGVSLKRSK------AENGGWVVITLAW...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Gallery of examples
• SDPpred

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TablePlugin 10 - 2002-03-07 - PeterThoeny . ... Table cell spacing. ... Set CELLSPACING = 1 . ... 05 Jan 2002 PTh: Fixed sorting bug of cells with leading white space . 06 Dec 2001 PTh: Fixed date sorting bug . 03 Dec 2001 PTh: Fixed sort="off" bug and more . 29 Nov 2001: PTh fixed Perl warnings . 16 Nov 2001: PTh added table border, cell spacing, cell padding, gif files . ...

Еще в разделе: (Показать все результаты (>41098) - dualopt1.cmm.msu.ru/ )

• TablePlugin - TWiki - TWiki

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>241) - monkey.belozersky.msu.ru/ )

• Example of supporting positions
• ETS numeration assumed
• SCOP famyli:

... The <P> element is used to define a paragraph. ... The ALIGN attribute can be used to explicitly specify the horizontal alignment. ... Note: Do not use empty paragraphs to add white space around headings, lists or other elements. ... By convention, the class names are interpreted hierarchically, with the most general class on the left and the most specific on the right, where classes are separated by a period. ... You can then explicitly specify line breaks in paragraphs using the BR element. ...

Еще в разделе: (Показать все результаты (>482) - comet.sai.msu.ru/ )

• HTML Math
• Examples of repeating parts of the text
• Example of how mail is displayed

The QBoxLayout class lines up child widgets horizontally or vertically. ... QBoxLayout  ( QWidget * parent, Direction, int border=0, int autoBorder = -1, const char * name=0 )  . ... QBoxLayout takes the space it gets (from its parent layout or from the mainWindget()), divides it up into a row of boxes and makes each managed widget fill one box. ... The stretch factor applies only in the direction of the QBoxLayout, and is relative to the other boxes and widgets in this QBoxLayout. ...

Еще в разделе: (Показать все результаты (>579) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_example
• Qt Toolkit - trivial/trivial.cpp example file
• Qt Toolkit - QLabel Class

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>429) - itpm.msu.su/ )

• mod_file_cache - Apache HTTP Server
• Another Example
• Examples

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>92) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use

... pair-cores/web: add internal link to example from alignment input field . ... pair_cores/web/approot/locales/pair-cores-web.xml pair_cores/web/approot/locales/pair-cores-web_ru.xml . ... 1.1 --- a/pair_cores/web/approot/locales/pair-cores-web.xml Mon Jan 14 19:48:26 2013 +0400 1.2 +++ b/pair_cores/web/approot/locales/pair-cores-web.xml Tue Jan 15 18:31:47 2013 +0400 1.3 @@ -1,7 +1,9 @@ 1.4 <?xml version="1.0" encoding="UTF-8"?> 1.5 <messages nplurals='2' plural="n==1 ? ...

Еще в разделе: (Показать все результаты (>28805) - kodomo.fbb.msu.ru/ )

• allpy: log
• allpy: b520e79fd1f4
• allpy: b412a580e998 test/test.py

... fc3:dokuwiki:example ]] . THEP . ... Show page . ... Media Files . ... dokuwiki-128.png . 128?128 . 23/082015 16:57 . ... fc3/dokuwiki/example.txt ۤ Last modified: 15/072005 12:05 (external edit) . Show page Old revisions . Media Manager Back to top . ...

Еще в разделе: (Показать все результаты (>13001) - theory.sinp.msu.ru/ )

. Электронная библиотека . механико-математического факультета . Московского государственного университета . Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . Мехматянам . Первый курс . Второй курс . Третий курс . Четвертый курс . Пятый курс . Поиск по указателям . Журнал Probability and Statistics by Example . 1. Probability and statistics by example (?1 2005) . Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . | | О проекте

Еще в разделе: (Показать все результаты (>8380) - lib.mexmat.ru/ )

• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная
• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Поиск книг, содержащих Counter example :: Электронная библиотека

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>49) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>3808) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) sprintf -- Return a formatted string . ... No argument is required. b - the argument is treated as an integer , and presented as a binary number . c - the argument is treated as an integer , and presented as the character with that ASCII value. d - the argument is treated as an integer , and presented as a (signed) decimal number . u - the argument is treated as an integer , and presented as an unsigned decimal ... Example 1. ...

Еще в разделе: (Показать все результаты (>827) - oit.cmc.msu.ru/ )

• printer_set_option
• preg_match_all
• PHP's Automatic Build System