The QMenuBar class provides a horizontal menu bar. ... Inherits QFrame and QMenuData . ... QMenuBar  ( QWidget * parent=0, const char * name=0 )  . ... virtual void  updateItem  ( int id )  . virtual void  show  ()  . virtual void  hide  ()  . ... virtual void  drawContents  ( QPainter * )  . virtual void  fontChange  ( const QFont & )  . virtual void  mousePressEvent  ( QMouseEvent * )  . virtual void  mouseReleaseEvent  ( QMouseEvent * )  . ... Reimplemented from QFrame. ...

Еще в разделе: (Показать все результаты (>755) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QDialog Class
• Qt Toolkit - QPushButton Class
• Qt Toolkit - QPaintDevice Class

... In our example we will implement a simple parser, which recognize space delimited words and has only two types (3, word, Word; 12, blank, Space symbols). Identifiers were chosen to keep compatibility with default headline() , since we won't implement our version. ... Returns a pointer to the internal structure of a parser. ... This procedure will be called so long as the procedure return token type = 0. ... Testing: =# SELECT * FROM parse('testparser','That''s my first own parser'); tokid | ...

Еще в разделе: (Показать все результаты (>1850) - www.sai.msu.su/ )

• The Name of the Plug-In: Example Images

To pass several arguments from the command line to the shell: cat first_5args # This script echoes the first five arguments # supplied to the script echo The first five command line echo arguments are $1 $2 $3 $4 $5 first_5args mines a pint john o.k. The first five command line arguments are mines a pint john o.k. This passes the arguments represented by parameters $1 through $5 to the shell script. ... This processes the three files given as arguments to the command printps . ...

Еще в разделе: (Показать все результаты (>510) - comet.sai.msu.ru/ )

• Examples of using command arguments
• Examples of passing arguments given to a command alias
• Examples of quoting special characters

... Example using MPI_SCAN . ... This example uses a user-defined operation to produce a segmented scan . ... the user-defined function */ void segScan( SegScanPair *in, SegScanPair *inout, int *len, MPI_Datatype *dptr ) { int i; SegScanPair c; . ... as in the following. int i,base; SeqScanPair a, answer; MPI_Op myOp; MPI_Datatype type[2] = {MPI_DOUBLE, MPI_INT}; MPI_Aint disp[2]; int blocklen[2] = { 1, 1}; MPI_Datatype sspair; . ... MPI_Scan( a, answer, 1, sspair, myOp, root, comm ); . ... Центры . ...

Еще в разделе: (Показать все результаты (>671) - www.parallel.ru/ )

• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Complications | PARALLEL.RU - Информационно-аналитический центр по параллельным

It is now possible to specify multiple log files, each with a fully customizable format. ... Multiple log files are implemented as part of the mod_log_config module which as of Apache 1.2 is the default log module. Multiple log files be created with either the TransferLog or CustomLog directive. These directives can be repeated to create more than one log file (in previous releases, only one logfile could be given per server configuration). ... Syntax: CustomLog filename "format" . ...

Еще в разделе: (Показать все результаты (>110) - neptun.sai.msu.ru/ )

• Apache module mod_example
• Apache's Handler Use
• Apache module mod_auth_digest

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>821) - uneex.lorien.cs.msu.su/ )

• mod_example - Apache HTTP Server
• mod_dav - Apache HTTP Server
• Apache 2.0 Hook Functions - Apache HTTP Server

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>180) - uneex.mithril.cs.msu.su/ )

• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• HelpOnSessions - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples

PHP Manual . ... This extension offers a PHP interface to the YAZ toolkit that implements the Z39.50 protocol for information retrieval. ... When invoked with no arguments it prints a query form; else (arguments are supplied) it searches the targets as given in in array host . $num_hosts = count ($ host ); if (empty($term) || count($ host ) == 0) { echo ' form method= get input type= checkbox name = host [] value= bagel.indexdata.dk/gils GILS test input type= checkbox name = ...

Еще в разделе: (Показать все результаты (>1258) - oit.cmc.msu.ru/ )

• sprintf
• Calling User Functions
• if..endif syntax

... ucar.netcdf.AbstractNetcdf . ... public abstract class AbstractNetcdf . ... Create an empty instance to be populated with instances of some subclass of Variable. protected . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... Returns the set of dimensions associated with this, the union of those used by each of the variables. protected void . ... Returns the set of dimensions associated with this, the union of those used by each of the variables. ...

Еще в разделе: (Показать все результаты (>160) - angel.cs.msu.su/ )

• : Class ConcreteIndexMap
• DataTableModel
• : Class NetcdfFile

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>517) - itpm.msu.su/ )

• mod_cache - Apache HTTP Server
• mod_dav - Apache HTTP Server
• Apache 2.0 Hook Functions - Apache HTTP Server

... file . ... file log . ... find changesets by author, revision, files, or words in the commit message . ... line source . ... 4 from repeat_joiner import Interval , RepeatJoiner . ... 8 line = line . ... 10 c1 , c2 , from1 , to1 , from2 , to2 , ori1 , ori2 = line . ... 13 ori1 = True if int ( ori1 ) == 1 else False . ... 15 from1 = int ( from1 ) . ... 17 from2 = int ( from2 ) . ... 20 r1 = Interval ( rj , c1 , from1 , to1 , ori1 ) . 21 r2 = Interval ( rj , c2 , from2 , to2 , ori2 ) . ...

Еще в разделе: (Показать все результаты (>15041) - kodomo.fbb.msu.ru/ )

• allpy: 21cfc7897a8f sandbox/ttk.py
• allpy: 21cfc7897a8f README.devel
• allpy: 21cfc7897a8f sandbox/wx-dc.py

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10368) - lib.mexmat.ru/ )

• Baird K.C. - Ruby by Example: Concepts and Code :: Электронная библиотека
• Onion F. - Essential ASP.NET With Examples in C# :: Электронная библиотека
• Buckland M. - Programming Game AI by Example :: Электронная библиотека

spectrum1d - compute auto- [and cross- ] spectra from one [or two] timeseries. spectrum1d [ x [ y ] file ] -S segment _ size ] [ -C ] [ -D dt ] [ -N name _ stem ] [ -V ] [ -W ] [ -bi [ s ][ n ] ] [ -bo [ s ] ] spectrum1d reads X [and Y] values from the first [and second] columns on standard input [or x [ y ] file ]. ... Units same as ypower. name _ stem .npower Power spectral density of the noise output. Units same as ypower. name _ stem .gain Gain spectrum, or modulus of the transfer function. ...

Еще в разделе: (Показать все результаты (>362) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/psscale.html
• http://xray.sai.msu.ru/~ivan/gmt/man/psrose.html
• http://xray.sai.msu.ru/~ivan/gmt/man/pstext.html

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

... A regular expression pattern to extract some text from a topic (does not search meta data; use $formfield instead). In case of a multiple="on" search, the pattern is applied to the line found in each search hit. ... SEARCH{ "FAQ" scope="topic" nosearch="on" nototal="on" header=" * *Topic: Summary:*" format=" * [[$topic]]: $summary" }% . SEARCH{ "FAQ" scope="topic" nosearch="on" nototal="on" header=" * *Topic: Summary:*" format=" * [[$topic]]: $summary" footer=" * *Topic: Summary*" }% . ...

Еще в разделе: (Показать все результаты (>40727) - dualopt1.cmm.msu.ru/ )

• TwistyContrib - TWiki - TWiki - (printable)
• GluePlugin - TWiki - TWiki - (printable)
• GluePlugin - TWiki - TWiki

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>1916) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for example showing inside vs. outside list marker
• Long description of example illustrating hidden internal borders

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>75) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>7066) - wiki.cmc.msu.ru/ )

• UpdateInfoPlugin < System < Foswiki
• (r1) UpdateInfoPlugin < System < Foswiki