... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ... 8.12.2005, 0:27 . ...

Еще в разделе: (Показать все результаты (>461) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Ассоциации
• Студенческий форум Физфака МГУ > Current Doing
• Студенческий форум Физфака МГУ > Игра "кошка или собака"

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

Еще в разделе: (Показать все результаты (>3) - www.srcc.msu.ru/ )

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>29) - smdc.sinp.msu.ru/ )

• ShielDose2 model - Space monitoring data center

Astronomy Picture of the Day . NGC 5307: A Symmetric Planetary Nebula . ... This picture taken by the Hubble Space Telescope was released last week. NGC 5307 is an example of a planetary nebula with a spiral shape. ... The layers of the Saturn Nebula give a complex picture of how this planetary nebula was created. The above picture, taken in April 1996 and released last week, allows a better understanding of the mysterious process that transformed a low-mass star into a white dwarf star. ...

Еще в разделе: (Показать все результаты (>4357) - www.astronet.ru/ )

• NGC 5307: A Symmetric Planetary Nebula
• High Noon Analemma Over Azerbaijan
• Journal "Peremennye Zvezdy"

... Globalization and interdependence of societies made Human Rights and Human Development an important concern for countries as well as one of the reasons for international cooperation between them. In this article the question of potential integration of Human Rights and Development as well as ways of how these processes can contribute to each other will be analyzed. ... Second, human rights and development creates empowerment of people and development can base on this in its process. ...

Еще в разделе: (Показать все результаты (>65) - www.prof.msu.ru/ )

• Some Ideas in Current Situation in our Country
• NGOs: The Carriers of Globalization?
• About the importance of founding teleecommunication centres in developing areas

... создается некое подобие 3-х мерного пространства Слова показа и и отображены таким же способом. -- param name =example_object_0 value = pltext step =20 font =Verdana:28,3 value =%АППЛЕТ% link = exline :0 color =#009999 param name =example_object_1 value = pltext step =20 shifts=2,2 font =Verdana:28,3 value =%АППЛЕТ% link = ...

Еще в разделе: (Показать все результаты (>15) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer4text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/cursor/cursor1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer1text1.htm

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>62) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly
• Firefly DOCUMENTATION - command line arguments
• PC GAMESS/Firefly DOCUMENTATION - Cube files

... Mathematical Treatment of Exhaust Systems with Acoustic Properties Using Mathlie I. Algorithms . ... The first part of the two talks is concerned with   algorithms applied to examples origin from an   exhaust system. ... The model equations are determined   by conservation of mass, momentum and energy. In addition there exists an equation of state   for the ideal gas system. ... Applying computer algebra to   these model equations, we demonstrate that   solutions can be derived. ...

Еще в разделе: (Показать все результаты (>94) - acs366.phys.msu.su/ )

... Using Intel Xeon Phi coprocessors for execution of natural join on compressed data" . ... This coprocessor uses distributed columnar indexes with interval fragmentation. The operation of the coprocessor engine is considered by an example of natural join processing. ... Keywords: columnar data representation, columnar indexes, database coprocessor, interval fragmentation, parallel database system, cluster computing systems with many-core accelerators, Intel Xeon Phi. ...

Еще в разделе: (Показать все результаты (>215) - num-meth.srcc.msu.ru/ )

• "Wavelet crosscorrelations of two-dimensional signals"
• "Application of the Monte Carlo method for estimating the total time of solving
• A hybrid heuristic parallel method of global optimization

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>130) - lnfm1.sai.msu.ru/ )

• Calibration data
• IDL programs
• FITShdr: INSTALL

LangueDOC . ... Languages . ... Archi . ... The phonetic system of Archi is very rich, and the writing systems that are familiar to Archi speakers (Russian cyrillic and Avar cyrillic) are not sufficient for recording all sounds of the language. ... Kibrik et al. 1977] ? the notation used in this dictionary is given in the comparative table below under the label "1977"; [Kibrik, Kodzasov 1990]), but they were too difficult for the Archi speakers to learn and therefore remained inaccessible to them. ...

Еще в разделе: (Показать все результаты (>206) - www.philol.msu.ru/ )

Plyashechnik A.S. Equivalence of Two Definitions of a Chronological Integral . ... Chirskii V.G. Algebraic Independence over Q p of Values of Analytic Functions at Points from C p . ... Brovko G.L. Models and Problems for Saturated Porous Media . Georgievskii D.V. Growth Estimates of Perturbations in Eigenvalue Problems for the Rayleigh Equation . ... Index of papers and matherials published in the Journal "Vestnik Moskovskogo Universiteta. ... 1, Matematika. Mekhanika" during 2010 year . ...

Еще в разделе: (Показать все результаты (>86) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

METHOD FOR FACE TRACKING IN VIDEO SEQUENCE Loshkarev I.V., Demyanenko Y.M. Southern Federal University, 8a Milchakova st., Rostov-on-Don, 344090, Russia One of the established standards for face tracking in the image is method developed by Viola and Jones [1]. ... Then the template is constructed using the contour representation of the face. With this representation, position and orientation of the face in next frames can be obtained using the generalized Hough transform [2]. ...

Еще в разделе: (Показать все результаты (>100) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc172878/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15960/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc19190/eng.pdf

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>8) - comphep.sinp.msu.ru/ )

• tutorials [CompHEP]

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>111) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee service

Thursday, June 24th, 2010 . ... Wednesday, June 16th, 2010 . На сайт добавлен пакет Lightbox 2.04 (http://www NULL .huddletogether NULL .com/projects/lightbox2/) (by Lokesh Dhakar) для отображения графики с дополнительными визуальными эффектами: . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for June, 2010. ... Наши публикации . ... Публикации за 2011 . Публикации за 2012 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>11) - geo.sai.msu.ru/ )

• Lightbox 2 Лаборатория лазерной интерферометрии
• site lightbox Лаборатория лазерной интерферометрии
• Uncategorized Лаборатория лазерной интерферометрии

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>28) - www.msu.ru/ )

COMPUTER DESIGN OF HETEROCYCLIC RING-OPENING REACTIONS. ... Since the cleavage of ring bond requires appearance of new bond either between th e (endo) atoms of initial cycle, or between initial cycle and external (exo) group, the first case is treated as endoopening, and the another as exo-opening: Endo-Ring Opening Exo-Ring Opening © 1995 American Institute of Physics 75 7 758 Heterocyclic Ring-Opening Reactions General Methodology and Algorithms 1. ... RULE FOR ENDO-TYPE RJNG OPENING. ...

Еще в разделе: (Показать все результаты (>103) - www.chem.msu.ru/ )

• Program ODF3

Название статьи И.О. Фамилия11,a, И.О. Фамилия22,b 1 Название института и полный адрес, например: Московский государственный университет имени М.В.Ломоносова, физический факультет, кафедра общей физики. ... Title in English I.O. Pervyiavtor1,a , I.O. Vtoroiavtor2,b 1 Название института и адрес на английском языке, например: Department of [.. ... Moscow 119991, Russia. 2 Название института и адрес на английском языке, например Sternberg State Institute of Astronomy, Moscow State University. ...

60. Handwritings (MW)