... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>774) - uneex.lorien.cs.msu.su/ )

• DVARP
• DAVERAGE
• DCOUNTA

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>171) - uneex.mithril.cs.msu.su/ )

• HelpOnImages - UNИX

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>6619) - wiki.cmc.msu.ru/ )

. Homepage . Belozersky Institute . GeneBee . Russian EMBnet Node . ALiComp - GeneBee Alignments Comparison . Help . Advanced query . Alignment title . Picture types . Offsets comparison Column values comparison Col. values comparison 2 . First alignment ( Example ) . Second alignment ( Example ) . Last updated: August 26 2001. Comments and bug-reports send to: nik@genebee.msu.su

Еще в разделе: (Показать все результаты (>126) - www.genebee.msu.ru/ )

• GeneBee Graphical Alignment - Advanced
• AliComp - GeneBee Alignment Comparison Help
• RNA secondary structure prediction

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6982) - mouse.belozersky.msu.ru/ )

• Alignment example
• Geometrical core
• LCore

... Cell border width (pixels). unspecified . ... Column to sort initially ( "1" to number of columns). unspecified . ... Data cell alignment, one value for all columns, or a comma separated list for different alignment of individual columns. ... Data cell background colour of a sorted column; see databg . ... Data cell text colour, a comma separated list. unspecified . ... Header cell alignment, one value for all columns, or a comma separated list for different alignment of individual columns. ...

Еще в разделе: (Показать все результаты (>40170) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki

... pair-cores/web: add internal link to example from alignment input field . ... 4 from allpy import dna . ... 25 blocks = [] . 26 in_block = False . ... 29 in_block , was_in_block = is_good_window ( window ), in_block . 30 if in_block and not was_in_block : . ... Block . from_alignment ( alignment , columns = list ( window )) . ... 33 elif in_block : . ... 37 def blocks_markup ( alignment , blocks ): . ... in_block for column in alignment . ... 57 blocks_markup ( alignment , blocks ), . ...

Еще в разделе: (Показать все результаты (>33641) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 test/usecase2.py
• allpy: 21cfc7897a8f test/usecase2.py
• allpy: ddf85d0a8924 test/usecase2.py

This diagram gives one visual rendering of a table that has been marked up especially for aural rendering. The table has a centered caption above it that reads "Travel Expense Report". ... In order to group information in a useful way, the table has a central column group with three columns, labeled "Meals", "Hotels", and "Transport" from left to right. The table's first column (to the left of the central column group) lists days of travel and labels these days with the city visited. ...

Еще в разделе: (Показать все результаты (>995) - crydee.sai.msu.ru/ )

• Long description of example illustrating table row height calculations and
• Long description of example illustrating precedence in the collapsing borders
• Long description of example of cell background calculation

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>27) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... MLNKLSAEFFGTFWLVFGGCGSAILAA--AFP------ELGIGFLGVALAF . ... SSLAPAG-FAPIAIGFGLTLIHLVSIPVTNTWVNPARSTG--VA--LF-----ADTAAL . ... MGRKLLAEFFGTFWLVFGGCGSAVFAA--AFP------ELGIGFTGVALAF . ... HGRVPAG-FAPIAIGLALTLIHLISIPVTNTSVNPARSTG--QA--LF-----VGGWAL . ... MSQT---STLKGQCIAEFLGTGLLIFFGVGCVA--ALKVAG------ASFGQWEISVI-W . ... ANQFTEG-LNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFL---PIPGKGSS . ... YPHFKATED-----QG-----AKLAVFSTDP-AIKHLPANFFSEVLGTFVLVLGILAIG- . ... MIDTSLATQFLGEVIGTAILIILGAGVVAGVSLKRSK------AENGGWVVITLAW...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Algorithm Format requirements
• User's guide

This example shows simple and intermediate use of Qt's layout classes, QGridLaout, QBoxLayout etc. ... QMenuBar *menubar = new QMenuBar ( this ); menubar-> setSeparator ( QMenuBar::InWindowsStyle ); QPopupMenu * popup; popup = new QPopupMenu ; popup-> insertItem ( "&Quit", qApp, SLOT(quit()) ); menubar-> insertItem ( "&File", popup ); // ...and tell the layout about it. topLayout->setMenuBar( menubar ); // Make an hbox that will hold a row of buttons. ...

Еще в разделе: (Показать все результаты (>598) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - dirview/dirview.cpp example file
• Qt Toolkit - pref/pref.cpp example file
• Qt Toolkit - table/table.cpp example file

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>241) - monkey.belozersky.msu.ru/ )

• SDPpred
• SDP home page
• SCOP famyli:

... Examples using MPI_SCATTER, MPI_SCATTERV . ... Scatter sets of 100 ints from the root to each process in the group. ... MPI_Comm comm; int gsize,*sendbuf; int root, rbuf[100]; .. MPI_Comm_size( comm, &gsize); sendbuf = (int *)malloc(gsize*100*sizeof(int)); .. MPI_Scatter( sendbuf, 100, MPI_INT, rbuf, 100, MPI_INT, root, comm); figure=mycoll-fig7.ps,width=3.50in . Figure 8: The root process scatters sets of 100
 int
s to each process in the group. ... Центры . ...

Еще в разделе: (Показать все результаты (>398) - www.parallel.ru/ )

• Examples using MPI_GATHER, MPI_GATHERV | PARALLEL.RU -
• Subarray Filetype Constructor | PARALLEL.RU - Информационно-аналитический центр
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по

Электронная библиотека Попечительского совета . ... Mejlbro L. - Calculus 2c-4, Examples of Maximum and Minimum . ... Название: Calculus 2c-4, Examples of Maximum and Minimum . Автор: Mejlbro L. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8161) - lib.mexmat.ru/ )

• Mejlbro L. - Calculus 2c, Examples of Maximum and Minimum Integration and
• Burlew M. - SAS Guide to Report Writing: Examples :: Электронная библиотека
• Журнал Probability and Statistics by Example :: Электронная библиотека

To list the contents of the current directory: ls README bago.hlp helpex.hlp hyperhelp app-defaults helpex hoh.hlp . ... To list each subdirectory and its contents, repeating this recursion : ls -R uunet MetaCard README README.ftp uunet/MetaCard: BLURB.txt BUGS.txt FAQ.txt README.mc metacard uunet/MetaCard/metacard: Makefile XCmdGlue.c XTtemplate.c XtTemplate.c mc mchelp README.ext XCmdGlue.h XtGlue.c external.c mcXThelp mchome XCmdFuncs.c XCmdNames.h XtGlue.h external.h mcdemo mctools . ...

Еще в разделе: (Показать все результаты (>490) - comet.sai.msu.ru/ )

• HTML Math
• Examples of using the pr command
• Examples of using the ps command

... In our example we will implement a simple parser, which recognize space delimited words and has only two types (3, word, Word; 12, blank, Space symbols). Identifiers were chosen to keep compatibility with default headline() , since we won't implement our version. ... Returns a pointer to the internal structure of a parser. ... This procedure will be called so long as the procedure return token type = 0. ... Testing: =# SELECT * FROM parse('testparser','That''s my first own parser'); tokid | ...

Еще в разделе: (Показать все результаты (>1340) - www.sai.msu.su/ )

• Zen: tp search en
• Open Source Convention
• Zen: README q3c

filter1d - Time domain filtering of 1-D time series filter1d [ infile ] -F < type >< width > [ -D increment ] [ -E ] [ -H [ nrec ] ] [ -I ignore _ val ] [ -L lack _ width ] [ -N n _ cols / t _ col ] [ -Q q _ factor ] [ -S symmetry _ factor ] [ -T start / stop / int ] [ -V ] [ -bi [ s ][ n ] ] [ -bo [ s ] ] filter1d is a general time domain filter for multiple column time series data. The user specifies the number of columns of input and which column is the time. ...

Еще в разделе: (Показать все результаты (>288) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/minmax.html
• http://xray.sai.msu.ru/~ivan/gmt/man/splitxyz.html
• http://xray.sai.msu.ru/~ivan/gmt/man/sample1d.html

... 3.0.6 - 3.0.18 only, PHP 4 >= 4.0.0) odbc_fetch_into -- Fetch one result row into array . int odbc_fetch_into ( int result_id [, int rownumber, array result_array]) . ... Example 1. odbc_fetch_into() pre 4.0.6 example . rc = odbc_fetch_into($res_id, $my_array); . ... Future: In PHP 4.1, this function will be moved to the following format: int odbc_fetch_into ( int result_id, array result_array [, int rownumber]) Please note, that rownumber will be optional, while result_array is not. ...

Еще в разделе: (Показать все результаты (>884) - oit.cmc.msu.ru/ )

• sprintf
• wordwrap
• ovrimos_fetch_row

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>94) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use