The QMenuBar class provides a horizontal menu bar. ... Inherits QFrame and QMenuData . ... QMenuBar  ( QWidget * parent=0, const char * name=0 )  . ... virtual void  updateItem  ( int id )  . virtual void  show  ()  . virtual void  hide  ()  . ... virtual void  drawContents  ( QPainter * )  . virtual void  fontChange  ( const QFont & )  . virtual void  mousePressEvent  ( QMouseEvent * )  . virtual void  mouseReleaseEvent  ( QMouseEvent * )  . ... Reimplemented from QFrame. ...

Еще в разделе: (Показать все результаты (>783) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QDialog Class
• Qt Toolkit - QSlider Class
• Qt Toolkit - QPushButton Class

... In our example we will implement a simple parser, which recognize space delimited words and has only two types (3, word, Word; 12, blank, Space symbols). Identifiers were chosen to keep compatibility with default headline() , since we won't implement our version. ... Returns a pointer to the internal structure of a parser. ... This procedure will be called so long as the procedure return token type = 0. ... Testing: =# SELECT * FROM parse('testparser','That''s my first own parser'); tokid | ...

Еще в разделе: (Показать все результаты (>1376) - www.sai.msu.su/ )

• The Name of the Plug-In: Example Images
• GIMP Plug-In Examples
• The Sparkle Plug-In: Example Images

... Library Example #2 . Up: Motivating Examples Next: Inter-Communication Previous: Library Example #1 . ... main(int argc, char **argv) { int ma, mb; MPI_Group MPI_GROUP_WORLD, group_a, group_b; MPI_Comm comm_a, comm_b; . static int list_a[] = {0, 1}; #if defined(EXAMPLE_2B) | defined(EXAMPLE_2C) static int list_b[] = {0, 2 ,3}; #else/* EXAMPLE_2A */ static int list_b[] = {0, 2}; #endif int size_list_a = sizeof(list_a)/sizeof(int); int size_list_b = sizeof(list_b)/sizeof(int); .. ...

Еще в разделе: (Показать все результаты (>418) - www.parallel.ru/ )

• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Example using MPI_SCAN | PARALLEL.RU - Информационно-аналитический центр по
• Complications | PARALLEL.RU - Информационно-аналитический центр по параллельным

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>784) - uneex.lorien.cs.msu.su/ )

• mod_dav - Apache HTTP Server
• mod_auth_digest - Apache HTTP Server
• mod_example - Apache HTTP Server

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>168) - uneex.mithril.cs.msu.su/ )

• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• HelpOnSessions - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... To enable mod_dav , add the following to a container in your httpd.conf file: . ... In addition, a location for the DAV lock database must be specified in the global section of your httpd.conf file using the DavLockDB directive: . ... In order for mod_dav to manage files, it must be able to write to the directories and files under its control using the User and Group under which Apache is running. ...

Еще в разделе: (Показать все результаты (>458) - itpm.msu.su/ )

• mod_auth_digest - Apache HTTP Server
• mod_example - Apache HTTP Server
• mod_cache - Apache HTTP Server

It is now possible to specify multiple log files, each with a fully customizable format. ... Multiple log files are implemented as part of the mod_log_config module which as of Apache 1.2 is the default log module. Multiple log files be created with either the TransferLog or CustomLog directive. These directives can be repeated to create more than one log file (in previous releases, only one logfile could be given per server configuration). ... Syntax: CustomLog filename "format" . ...

Еще в разделе: (Показать все результаты (>99) - neptun.sai.msu.ru/ )

• Apache module mod_example
• Apache's Handler Use
• Apache module mod_auth_digest

PHP Manual . ... This extension offers a PHP interface to the YAZ toolkit that implements the Z39.50 protocol for information retrieval. ... When invoked with no arguments it prints a query form; else (arguments are supplied) it searches the targets as given in in array host . $num_hosts = count ($ host ); if (empty($term) || count($ host ) == 0) { echo ' form method= get input type= checkbox name = host [] value= bagel.indexdata.dk/gils GILS test input type= checkbox name = ...

Еще в разделе: (Показать все результаты (>880) - oit.cmc.msu.ru/ )

• if..endif syntax
• Apache HTTP Server: Security Tips
• FTP functions

... To prevent the shell from expanding an argument containing several special characters: $ sed -e 1,$s/V[0-9].*: //p /etc/motd sed: command garbled: 1,/V[0-9].*: $ sed -e '1,$s/V[0-9].*: //p' /etc/motd DYNIX/ptx(R) Tue Feb 25 12:04:15 GMT 1993 . ... To prevent the shell from expanding special characters but allow command substitution: echo 'My working directory is `pwd`' My working directory is`pwd` echo "My working directory is `pwd`" My working directory is /home/jane/docs . ...

Еще в разделе: (Показать все результаты (>476) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Example of debugging a shell script
• Examples of editing previous command lines

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Электронная библиотека Попечительского совета . ... Baird K.C. - Ruby by Example: Concepts and Code . ... Название: Ruby by Example: Concepts and Code . Автор: Baird K.C. Аннотация: . ... Ruby by Example analyzes a series of Ruby scripts, examining how the code works, explaining the concepts it illustrates, and showing how to modify it to suit your needs. ... Extend Ruby using RubyGems, the Ruby package manager . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8587) - lib.mexmat.ru/ )

• Onion F. - Essential ASP.NET With Examples in C# :: Электронная библиотека
• Buckland M. - Programming Game AI by Example :: Электронная библиотека
• Журнал Probability and Statistics by Example :: Электронная библиотека

... A regular expression pattern to extract some text from a topic (does not search meta data; use $formfield instead). In case of a multiple="on" search, the pattern is applied to the line found in each search hit. ... SEARCH{ "FAQ" scope="topic" nosearch="on" nototal="on" header=" * *Topic: Summary:*" format=" * [[$topic]]: $summary" }% . SEARCH{ "FAQ" scope="topic" nosearch="on" nototal="on" header=" * *Topic: Summary:*" format=" * [[$topic]]: $summary" footer=" * *Topic: Summary*" }% . ...

Еще в разделе: (Показать все результаты (>40588) - dualopt1.cmm.msu.ru/ )

• TwistyContrib - TWiki - TWiki - (printable)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... In this first example, we allow an object to fall onto a small radar unit . The resulting Time-Frequency distribution is shown as a contour plot in Fig. 8 (a). Figure: FIGURE GOES SOMEWHERE IN THIS GENERAL VICINITY . ... Its density plot appears as an image in Fig. ... The response has a very high peak, as evidenced from Fig. ...

Еще в разделе: (Показать все результаты (>1536) - crydee.sai.msu.ru/ )

• Long description for example showing how structurally overlapping cells are
• One example
• Feature enhancement: local maxima

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... ucar.netcdf.AbstractNetcdf . ... public abstract class AbstractNetcdf . ... Create an empty instance to be populated with instances of some subclass of Variable. protected . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... Returns the set of dimensions associated with this, the union of those used by each of the variables. protected void . ... Returns the set of dimensions associated with this, the union of those used by each of the variables. ...

Еще в разделе: (Показать все результаты (>155) - angel.cs.msu.su/ )

• : Class ConcreteIndexMap
• DataTableModel
• BackgroundTableModel

Copyright 1999-2014 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI= 4 inherit versionator DESCRIPTION= A massively-parallel software build system implemented on top of GNU make HOMEPAGE= http ://kolpackov.net/projects/ build / SLOT = $(get_version_component_range 1-2 ) SRC_URI= http ://www.codesynthesis.com/download/${PN}/${ ...

Еще в разделе: (Показать все результаты (>19998) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sys-fs/fuse/fuse-2.9.4.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc4735.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc4735.txt

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>794) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

... file . ... file log . ... Implemented markup fileIO (closes #56) This is done by adding file format 'markup' or 'markup:formatname', where 'formatname' is otherwise known alignment format. The file format for is described briefly in fileio.MarkupFile docstrings. ... 1 Using library in-place . ... 21 NEWS file contains news that are important to the library users, not to the . ... 23 contain a word about bugfix, if that bugfix was important and could cause users . ... 29 Example file format :: . ...

Еще в разделе: (Показать все результаты (>9114) - kodomo.fbb.msu.ru/ )

• allpy: 21cfc7897a8f sandbox/wx-dc.py
• allpy: README.devel annotate
• snake: log