... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2316) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... We provide a demo program that implements the following image processing algorithms: . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ...

Еще в разделе: (Показать все результаты (>54) - imaging.cmc.msu.ru/ )

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1562) - kodomo.cmm.msu.ru/ )

• / (log) ? Python Battle
• examples.zip тАУ Cyclyc Cell Automata

UpdateInfoPlugin will add a "new" or "updated" icon after a WikiWord link if a %ISNEW% tag is used after the link, and the linked topic was recently touched. ... WikiWord - if the topic is younger than five days and is revision 1.1 . ... Default values for the "version" and "days" parameters are set sitewide here in UpdateInfoPlugin#PluginSettings , but can be overridden pr. topic (or in WebPreferences pr. web), by setting variables UPDATEINFOVERSION and/or UPDATEINFODAYS . ... 20 Apr 2006: . ...

Еще в разделе: (Показать все результаты (>7015) - wiki.cmc.msu.ru/ )

• (r2) UpdateInfoPlugin < System < Foswiki
• (r1) UpdateInfoPlugin < System < Foswiki
• JQueryTreeview < System < Foswiki

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>417) - zmmu.msu.ru/ )

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. ... Filter for VirtualDub MSU Deblocking (68 KB, ZIP) . ...

Еще в разделе: (Показать все результаты (>189) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Graphics and Media Lab
• Smart brightness and contrast correction | Лаборатория компьютерной графики и
• Smart brightness and contrast correction | Graphics and Media Lab

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>38) - hist.msu.ru/ )

... Author(s): Joern Zaefferer . Version: 1.4 . Lightweight and flexible transformation of an unordered list into an expandable and collapsable tree, great for unobtrusive navigation enhancements. ... See the Foswiki:Extensions/RenderPlugin how to implement such REST handlers easily. list . item . ... list . ... This topic: System > JQueryPlugin > JQueryTreeview . Topic revision: revision 1 . Copyright by the contributing authors. ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>2254) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki
• VarENCODE < System < Foswiki

.. , . .. (e-mail: ardyana@yandex.ru) , , corruption, corrupt relations, social control of corrupt relations : , . . The article considers the successfully implemented measures of social control of corrupt relations on the example of three countries: USA, Germany and Singapore. Given the current theoretical and methodological approaches to the control of corruption model of social control are derived in these countries.

Еще в разделе: (Показать все результаты (>10) - vestnik.socio.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>12) - antares.sinp.msu.ru/ )

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>175) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>50) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

... Sun , 19 Dec 2010 19:49:53 GMT Daniil Alexeyevsky me.dendik@тАж [41:bcad0f5464bf] * snake.py ( modified ) snake.Rule.load: give reasonable error rather than crash on empty lines Sun , 19 Dec 2010 19:46:39 GMT Daniil Alexeyevsky me.dendik@тАж [40:94945f11c78d] * snake.py ( modified ) snake.Snake.fill: tail takes precedence over body head Sun , 19 Dec 2010 19:45:31 GMT Daniil ...

Еще в разделе: (Показать все результаты (>429) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=2f62804e21fcf2dd9b5fea344b8dd2c7387c3166&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=58%3Ab46dd72b6afe&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=b46dd72b6afeb49e9154d11d1550293b5bcf7a07&limit=100&mode=stop_on_copy

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>14) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

psimage - To plot SUN rasterfiles on maps psimage rasterfile -W xlength [/ ylength ] [ -C xpos / ypos ] [ -Gb r / g / b ] [ -Gf r / g / b ] [ -I ] [ -K ] [ -M ] [ -N nxrep / nyrep ] [ -O ] [ -P ] [ -U[ dx / dy / ][ label ] ] [ -V ] [ -X x - shift ] [ -Y y - shift ] [ -c copies ] psimage reads a 1, 8, 24, or 32-bit Sun rasterfile and plots it on a map. ... W Sets the size of the image in INCH. ... K More PostScript code will be appended later [Default terminates the plot system]. ...

Еще в разделе: (Показать все результаты (>263) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/example19.html
• http://xray.sai.msu.ru/~ivan/gmt/example03.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdhisteq.html

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>5) - www.sciencepark.ru/ )

• MSU Science Park - Venue & Space

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>98) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf
• http://qfthep.sinp.msu.ru/talks/GRACE.pdf
• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

Еще в разделе: (Показать все результаты (>3) - www.srcc.msu.ru/ )