... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) mail -- send mail . bool mail ( string to, string subject, string message [, string additional_headers [, string additional_parameters]]) . ... Kelly kelly@ example .com ; /* subject */ $ subject = Birthday Reminders for August ; /* message */ $ message = ' html head title Birthday Reminders for August /title /head body p Here are the birthdays upcoming in August ! /p table tr th Person /th th Day /th th Month /th th Year ...

Еще в разделе: (Показать все результаты (>612) - oit.cmc.msu.ru/ )

... Apache HTTP Server Version 2.0 . ... On systems with multiple users, each user can be permitted to have a web site in their home directory using the UserDir directive. Visitors to a URL http://example.com/~username/ will get content out of the home directory of the user " username ", out of the subdirectory specified by the UserDir directive. Per-user web directories . ... the URL http://example.com/~rbowen/file.html will be translated to the file path /home/rbowen/public_html/file.html . ...

Еще в разделе: (Показать все результаты (>660) - itpm.msu.su/ )

• mod_dav - Apache HTTP Server
• VirtualHost Examples - Apache HTTP Server
• Binding - Apache HTTP Server

When Apache starts, it connects to some port and address on the local machine and waits for incoming requests. By default, it listens to all addresses on the machine, and to the port as specified by the Port directive in the server configuration. ... There are two directives used to restrict or specify which addresses and ports Apache listens to. ... Listen can be used to make a single Apache server listen to more than one address and/or port. ... Syntax: Listen [ port | IP-address:port ] . ...

Еще в разделе: (Показать все результаты (>128) - neptun.sai.msu.ru/ )

• VirtualHost Examples
• Apache Multiple Log Files
• Apache module mod_auth_anon.c

... If username is specified but not # the groupname, the user's login group is used. username = "murmur"; groupname = "murmur"; # Root channel must always be defined first. If a channel has a parent , the parent must be defined before the child channel (s). channels = ( { name = Root ; parent = ; description = The Root of all channels ; noenter = true; }, { name = Lobby ; parent = Root ; description = Lobby channel ; }, { name = Red team ; parent = ...

Еще в разделе: (Показать все результаты (>23308) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc720.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc720.txt.pdf
• http://mirror.msu.net/pub/gentoo-portage/net-analyzer/zabbix/files/2.2/zabbix_agentd.conf

... This function can also be used for particular types of subtypes or kinds: KIND (0) integer KIND (0.0) floating point number KIND (.FALSE.) logical variable KIND ("A") string of characters There is an intrinsic function SELECTED_REAL_KIND , which returns the kind of the type REAL that has a representation with (at least) the precision and the exponential range requested. ... With the choice SELECTED_INT_KIND (5) all integers between (but not including the limits) -100 000 and +100 000 are permitted. ...

Еще в разделе: (Показать все результаты (>4976) - crydee.sai.msu.ru/ )

• The new precision concept
• Long description of example illustrating background calculation
• Summary of Fortran 77 statements

... Example: %URLPARAM{"skin"}% returns print for a .../view/TWiki/VarURLPARAM?skin=print URL . ... URL parameters passed into HTML form fields must be entity ENCODEd . ... Example: <input type="text" name="address" value="%URLPARAM{ "address" encode="entity" }%" /> . ... Watch out for TWiki internal parameters, such as rev , skin , template , topic , web ; they have a special meaning in TWiki. ... If you have %URLPARAM{ in the value of a URL parameter, it will be modified to %<nop>URLPARAM{ . ...

Еще в разделе: (Показать все результаты (>41477) - dualopt1.cmm.msu.ru/ )

• VarURLPARAM - TWiki - TWiki - (printable)
• VarURLPARAM - TWiki - TWiki
• VarTABLE - TWiki - TWiki - (printable)

... help . find changesets by author, revision, files, or words in the commit message . ... Specifying File Sets . ... show changeset information by line for each file . ... show revision history of entire repository or files . ... set or show the current phase name . ... output the current or given revision of files . ... search for a pattern in specified files and revisions . ... identify the working copy or specified revision . ... show the parents of the working directory or revision . ...

Еще в разделе: (Показать все результаты (>10368) - kodomo.fbb.msu.ru/ )

• Help: patterns

... help . find changesets by author, revision, files, or words in the commit message . ... Specifying File Sets . ... show changeset information by line for each file . ... show revision history of entire repository or files . ... set or show the current phase name . ... output the current or given revision of files . ... search for a pattern in specified files and revisions . ... identify the working copy or specified revision . ... show the parents of the working directory or revision . ...

Еще в разделе: (Показать все результаты (>2842) - kodomo.cmm.msu.ru/ )

• TracWorkflow тАУ Tanchiki
• TracNotification тАУ Tanchiki
• TracFineGrainedPermissions тАУ Tanchiki

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15664) - lib.mexmat.ru/ )

• Mejlbro L. - Complex Functions Examples c-2 - Analytic Functions :: Электронная
• Mejlbro L. - Complex Functions Examples c-6 - Calculus of Residues ::
• Mejlbro L. - Complex Functions Examples c-7 - Applications of the Calculus of

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>18) - mouse.genebee.msu.ru/ )

Options can be grouped together: ls -FI . ... Directories are shown with a trailing '/'; files which have execute permission are shown with a trailing '*'. ... Some options need to be given separately: lpr -Plp2 -#4rm report.ps . This prints four copies of the file report.ps , removes the file and sends mail to the user on completion. The option -Plp2 which specifies the printer to be used is given separately from the other options. If the command were given as lpr -Plp2#4rm report.ps . ...

Еще в разделе: (Показать все результаты (>550) - comet.sai.msu.ru/ )

• The ADDRESS element
• Fill-Out Forms
• Examples of using cp with special characters

... Master Education . ... Master programs . ... Master program "Mathematical Models of Complex Systems: Theory, Algorithms, Applications" . ... The Mathematical Models of Complex Systems: Theory, Algorithms and Applications Master?s programme is aimed at studying the foundations of computational methods and software for new types of current problems in modelling, decision-making, and control of complex systems. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>131) - hcs.cmc.msu.ru/ )

... Generation of octree meshes with cut cells in multiple material domains" . Chernyshenko A.Yu. An algorithm for the generation of octree meshes with cut cells generation in complex multiple material domains is proposed. The method of cell cutting is based on the cubical marching squares and multiple material marching cubes algorithms. ... Keywords: octree meshes, cut cells, hexahedral meshes, polyhedral meshes . PDF (in Russian) (1.57MB) . PDF. zip (in Russian) (1.34MB) . ...

Еще в разделе: (Показать все результаты (>232) - num-meth.srcc.msu.ru/ )

• "Complex supercomputer benchmarking"
• "Geometric modeling of complex configurations in aerodynamic problems"
• "Numerical study of spatial flows near complex configurations"

... NetCDF User's Guide for C . This appendix specifies the netCDF file format version 1. ... NC_VARIABLE nelems [var .. ... 4344 4601 0000 0000 0000 0000 0000 0000 C D F 001 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 17220 17921 00000 00000 00000 00000 00000 00000 [magic number ] [ 0 records ] [ 0 dimensions (ABSENT) ] 0000 0000 0000 0000 0000 0000 0000 0000 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 \0 00000 00000 00000 00000 00000 00000 00000 00000 [ 0 global atts (ABSENT) ] [ 0 variables (ABSENT) ] . ...

Еще в разделе: (Показать все результаты (>81) - angel.cs.msu.su/ )

• Appendix A Units
• : Class AbstractNetcdf

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>321) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Parsimony algorithm

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>87) - classic.chem.msu.su/ )

• Firefly DOCUMENTATION - command line arguments

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>184) - lnfm1.sai.msu.ru/ )

Symbolic circuit-matrix processor and evaluator . ... This software is reliable over the range of benchmark circuit complexity (both *.CIR and *.MAT file). ... SYMBOL is a symbolic-algebra package which in contrast to REDUCE, MACSYMA, MAPLE, MATHEMATICA, MathLAB, MathCAD and other known multi-purpose systems is especially intended for analysis of any lumped, linear, time-invariant circuit. ... pure ASCII text . ... CIRSYM - SYMbolic CIRcuit processor used to format ASCII text file *.out for CALCSYM. ...

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

• Complex evaluator

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6980) - mouse.belozersky.msu.ru/ )

• LCore
• Geometrical core
• Alignment example

VISA SUPPORT FORM |Family name| ... Date of | birth | __________________________________ If there is the second (or moreover) citizenship they are specified through a point State of birth ____________________ place of birth _______________________________________ country exact place of birth State of inhabitancy _________________ region___________________________________________ country region in the state of inhabitancy The closest Russian Consulate where you will ask for visa: ...

Еще в разделе: (Показать все результаты (>24) - foroff.phys.msu.ru/ )