Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>3) - npidb.belozersky.msu.ru/ )

• NPIDB: List of complexes
• NPIDB: About Us

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>7086) - monkey.belozersky.msu.ru/ )

• S publications
• Molecular biology databases

... The first-order intermolecular perturbation theory developed in the frame of diatomics-in-molecule approach is used to calculate the potential energy surfaces of the Ar.. Cl2 complex in the states which correlate with the X0g+ and B0u+ states of Cl2 fragment. ... Laboratory of Molecular Structure and Quantum Mechanics ...

Еще в разделе: (Показать все результаты (>1031) - chem.msu.ru/ )

• Publications of the Laboratory of Molecular Structure and Quantum Mechanics
• Supramolecular desigh of 1D coordination polymers based on silver(I) complexes
• (2-Diphenylphosphinoethyl)cyclopentadienyl Complexes of Zirconium (IV):

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>34) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• StructAlign help

This home page belongs to small group of scientists working at . Sternberg Astronomical Institute which is a part of Moscow State University . ... Электронная библиотека научно-технической и художественной литературы (доступна только из ГАИШ) . ... Local staff . Dr. Edward Kononovich (konon -at- sai.msu.ru), Associate Professor . ... Dr. Sergey Ayukov (asv -at- sai.msu.ru), Research Fellow, Webmaster of the group . ... Joint seminar of Solar Studies Structure Group and Solar Photometry Group . ...

Еще в разделе: (Показать все результаты (>2188) - crydee.sai.msu.ru/ )

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>13227) - lib.mexmat.ru/ )

• Lee D.H. - The Structure of Complex Lie Groups :: Электронная библиотека
• Kodaira K. - Complex manifolds and deformation of complex structures ::
• Reichardt J. - Structure in Complex Networks :: Электронная библиотека

... Moscow State Uiversity . ... Different wave function models and perturbations theory approximations are discussed, including the second Born one. ... Keldysh Institute of Applied Mathematics of RAS . DRIVER: Numerical investigation of aerodynamic and aeroacoustic charateristics of bluff aircraft elements and complex turbulent flows, design of better noise prediction tools for development of quieter aircrafts . ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• APPLICATIONS: Aerophysics | Moscow University Supercomputing Center
• APPLICATIONS: Geology | Moscow University Supercomputing Center
• APPLICATIONS: Inorganic Chemistry | Moscow University Supercomputing Center

... optimization of rasmol_homology: keep structure loaded of two sequences only One of steps of this program is superimposition of all sequences with main sequence and saving of all structures to pdb file. ... To implement this optimization methods supeimpose and save_pdb of alignment were replaced with methods with same names of sequence. ... Markup ): . ... 6 def from_record ( cls , container , record , name = None ): . ... 17 def to_record ( self ): . ... 30 for number , monomer in enumerate ( self ...

Еще в разделе: (Показать все результаты (>33839) - kodomo.fbb.msu.ru/ )

• allpy: bf873e4054c2 allpy/markups.py
• allpy: 53800c7e3458 allpy/markups.py
• allpy: 675b402094be lib/sequence.py

Projects . ... Modeling the tmRNA structure in the ribosome . For modeling of the tmRNA-2 structure in the ribosome we used the published ribosome X-ray structure with a defined mRNA path (Yusupova et al, 2006). ... Since the arch consisting of tmRNA pseudoknots and helices was observed by cryo-EM in the pre-initiation complex (Valle et al, 2003) as well as in the tmRNA-4 complex described here, we suggest that such a structure should be present at all steps of the tmRNA path through the ribosome. ...

Еще в разделе: (Показать все результаты (>33541) - dualopt1.cmm.msu.ru/ )

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>312) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/110.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/25.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/109.pdf

... X-ray structure analysis of hollow reconstituted beta-subunit capsids. ... The lumazine synthase/riboflavin synthase complex of Bacillus subtilis consists of an icosahedral capsid of 60 beta subunits enclosing a triplet of alpha subunits. ... Biol. 203, 1045-1070]. beta subunits were isolated after denaturation of the alpha 3 beta 60 complex and were subsequently reconstituted in a ligand-driven reaction yielding artifactual, hollow beta 60 capsids with icosahedral symmetry. ...

Еще в разделе: (Показать все результаты (>7561) - kodomo.cmm.msu.ru/ )

• Протокол практикума ?2
• DNA-Protein complexes
• Функции белка 1dfu

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>1031) - geo.web.ru/ )

• Второе приглашение на научно-практическую конференцию "Современные методы
• Dictionary_M
• Harvard Seismology: 3-D Earth Structure

Experimental Collaborations . Leading particles" -- E852 -- CMS -- "The Hall D Project" . Scintillation Magnetic Spectrometer MSU": experimental setup . ... fixed target experiment to trace the evolution of transient non-equilibrium hadronic states, as they penetrate through the nuclear matter . an experiment in the polarized proton beam to investigate spin phenomena in the proton-nucleus interactions . ... Participants from Hadronic Interactions Laboratory: . ...

Еще в разделе: (Показать все результаты (>78) - lav01.sinp.msu.ru/ )

... The role of intrinsically disordered regions in the structure and functioning of small heat shock proteins. ... Curr Protein Pept Sci. ... Small heat shock proteins (sHsp) form a large ubiquitous family of proteins expressed in all phyla of living organisms. ... Thus, disordered N- and C-terminal sequences play important role in the structure, regulation and functioning of sHsp. ...

Еще в разделе: (Показать все результаты (>104) - biochem.bio.msu.ru/ )

• NADH/NAD+ interaction with NADH: ubiquinone oxidoreductase (complex I).
• Biochemistry Department of Moscow State University | Regulation of muscle
• Heterooligomeric complexes formed by human small heat shock proteins HspB1

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>35) - analyt.chem.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Kovalevskaya Nadezhda V. , Smurnyy Yegor D. , Polshakov Vladimir I. , Birdsall Berry , Bradbury Alan F. , Frenkiel Tom , Feeney James . ... Polshakov V.I. , Birdsall B. , Frenkiel T.A. , Gargaro A.R. , Feeney J. в журнале Protein Science , издательство Cold Spring Harbor Laboratory Press (United States) , том 8, ? ...

Еще в разделе: (Показать все результаты (>6019) - istina.msu.ru/ )

• Smurnyy Yegor D. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Ryazanov M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Smirnov Eugeny G. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Next: Message buffer Up: 6.4.2 Message Queues Previous: Basic Concepts . The key to fully understanding such complex topics as System V IPC is to become intimately familiar with the various internal data structures that reside within the confines of the kernel itself. Direct access to some of these structures is necessary for even the most primitive operations, while others reside at a much lower level. ... Kernel msg structure . Kernel msqid_ds structure . Kernel ipc_perm structure . ...

Еще в разделе: (Показать все результаты (>223) - itpm.msu.su/ )

• Kernel ipc_perm structure
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL

. Parent Directory . Armenian1.pdf . CLS.pdf . ENEMY.pdf . Hieroglyphs.pdf . MUGH11.pdf . NUGAE.pdf . NUGAE2.pdf . SGHSUTRA.pdf . Sogd-ZY.pdf . Telibinu.pdf . Utu-as.pdf . clusters.pdf . labyrinth.pdf . luwian.pdf . lydian.pdf . palaic1.pdf . refl-ucla.pdf . sippanti.pdf . upe.pdf . wciec-paper.pdf

Еще в разделе: (Показать все результаты (>24) - imk.msu.ru/ )

• Index of /Structure/Linguistics/yakubovich

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6977) - mouse.belozersky.msu.ru/ )

• Geometrical core
• wLake program homepage
• S : 3D_of_rm_system_components

... This family contains a protein with resolved 3D structure: Q8UK99_AGRT5/3-102 , pdb ID: 1vqy . SDPsite predicts following important positions (numbering corresponds to 1vqy ): . ... 90S, 55W . ... 76W, 8Y, 46G, 55W, 39G, 63R . ... 8Y, 39G, 55W, 63R, 76W, 90S . ... Mapping predictions onto structure of 1vqy : . Associated grouping: . Group 1 . Q7ZWJ6_BRARE/154-253 . Q6DJ76_XENTR/154-253 . ... NPS3B_HUMAN/146-245 . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPsite - PF01399
• SDPsite - PF01722
• SDPsite - PF01206