S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>6435) - monkey.belozersky.msu.ru/ )

• S publications
• Molecular biology databases
• DNA/RNA-Protein structures

... 5DPK structure . Page of complex: 5DPK . Home Browse Download Help About Us . ... PDB ID . ... MUTY ADENINE GLYCOSYLASE BOUND TO A TRANSITION STATE ANALOG (1N) PAIRED WITH D(8-OXOG) IN DUPLEXED DNA TO 2.2 A . ... View in . ... Protein chains: . DNA chains: . ... 5dpk.pdb1.pdb . ... Pfam domains . ... Download file with secondary structure created by Stride . 5dpk.pdb1.pdb: [ download sequences in FASTA format ] . ... Click "SHOW" for view sequence . ... NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>18) - npidb.belozersky.msu.ru/ )

• NPIDB: Home
• NPIDB: List of complexes

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

• StructAlign help
• ConClus

Электронная библиотека Попечительского совета . ... Lee D.H. - The Structure of Complex Lie Groups . ... Название: The Structure of Complex Lie Groups . Автор: Lee D.H. Аннотация: . ... It then moves to the theory of representative functions of Lie groups- used as a primary tool in subsequent chapters-and discusses the extension problem of representations that is essential for studying the structure of complex Lie groups. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12682) - lib.mexmat.ru/ )

• Поиск книг, содержащих Квазикомплексная структура (almost complex structure) ::
• Reichardt J. - Structure in Complex Networks :: Электронная библиотека
• Caldarelli G., Vespignani A. - Large scale structure and dynamics of complex

... The first-order intermolecular perturbation theory developed in the frame of diatomics-in-molecule approach is used to calculate the potential energy surfaces of the Ar.. Cl2 complex in the states which correlate with the X0g+ and B0u+ states of Cl2 fragment. ... Laboratory of Molecular Structure and Quantum Mechanics ...

Еще в разделе: (Показать все результаты (>976) - chem.msu.ru/ )

• (2-Diphenylphosphinoethyl)cyclopentadienyl Complexes of Zirconium (IV):
• Molecular Structure and Physicochemical Properties of Acetone-Chloroform...
• Synthesis of sandwich and half-sandwich complexes of Ti, Zr and Hf containing

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>363) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/17.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/81.pdf
• MCCMB'11 program

This home page belongs to small group of scientists working at . Sternberg Astronomical Institute which is a part of Moscow State University . ... Электронная библиотека научно-технической и художественной литературы (доступна только из ГАИШ) . ... Local staff . Dr. Edward Kononovich (konon -at- sai.msu.ru), Associate Professor . ... Dr. Sergey Ayukov (asv -at- sai.msu.ru), Research Fellow, Webmaster of the group . ... Joint seminar of Solar Studies Structure Group and Solar Photometry Group . ...

Еще в разделе: (Показать все результаты (>940) - crydee.sai.msu.ru/ )

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>36) - analyt.chem.msu.ru/ )

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>1029) - geo.web.ru/ )

• Второе приглашение на научно-практическую конференцию "Современные методы
• Dictionary_M

... X-ray structure analysis of hollow reconstituted beta-subunit capsids. ... The lumazine synthase/riboflavin synthase complex of Bacillus subtilis consists of an icosahedral capsid of 60 beta subunits enclosing a triplet of alpha subunits. ... Biol. 203, 1045-1070]. beta subunits were isolated after denaturation of the alpha 3 beta 60 complex and were subsequently reconstituted in a ligand-driven reaction yielding artifactual, hollow beta 60 capsids with icosahedral symmetry. ...

Еще в разделе: (Показать все результаты (>4656) - kodomo.cmm.msu.ru/ )

• DNA-Protein complexes
• Функции белка 1dfu
• Протокол практикума ?2

... If there's no significant multiple alignment , including the sequence, that you interest, then the secondary structure is built, using only the energy model (just the potential energy of the system is minimized), but very often such method will give unreliable results. ... It should be mentioned that by default, at alignment case, the RNA secondary structure will be predicted for the first sequence of the alignment. ... It is done through optimizing, not the real, but model energy of the structure. ...

Еще в разделе: (Показать все результаты (>265) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• Laboratory of protein-nucleic interactions (Russian version)
• Databases

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>78) - www.intsys.msu.ru/ )

Next: Message buffer Up: 6.4.2 Message Queues Previous: Basic Concepts . The key to fully understanding such complex topics as System V IPC is to become intimately familiar with the various internal data structures that reside within the confines of the kernel itself. Direct access to some of these structures is necessary for even the most primitive operations, while others reside at a much lower level. ... Kernel msg structure . Kernel msqid_ds structure . Kernel ipc_perm structure . ...

Еще в разделе: (Показать все результаты (>170) - itpm.msu.su/ )

• Kernel ipc_perm structure
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL

... 2015 January 21 . The Complex Ion Tail of Comet Lovejoy . ... As the name implies, the ion tail is made of ionized gas -- gas energized by ultraviolet light from the Sun and pushed outward by the solar wind . ... The effect of the variable solar wind combined with different gas jets venting from the comet's nucleus accounts for the tail's complex structure. Following the wind, structure in Comet Lovejoy's tail can be seen to move outward from the Sun even alter its wavy appearance over time. ...

Еще в разделе: (Показать все результаты (>2163) - www.sai.msu.su/ )

• SAL- Numerical Analysis - Misc - sl++
• SAL- Other Scientific Fields - Chemistry, Biology Related - DCSE
• SAL- Computer Graphics, Images Signals - CAD, Drawing Painting Tools - ME10

... The Complex Ion Tail of Comet Lovejoy . ... As the name implies, the ion tail is made of ionized gas -- gas energized by ultraviolet light from the Sun and pushed outward by the solar wind. ... The effect of the variable solar wind combined with different gas jets venting from the comet's nucleus accounts for the tail's complex structure. ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: comet - comet tail . Publications with words: comet - comet tail . ...

Еще в разделе: (Показать все результаты (>5942) - www.astronet.ru/ )

• NGC 5189: An Unusually Complex Planetary Nebula
• Астронет > The Complex Ion Tail of Comet Lovejoy
• HH 222: The Waterfall Nebula

... day commit -- a lot of changes fasta.py: universal save_fasta() determine_long_line -- for determine length of fasta sequence string in user input everywhere: standart long_line=60 -- 70 blocK.sequences_chains: returns sequences in order as in project added monomer pdb_secstr to store secondary structure pdb adding: some improvements and fixes fix in from_pdb_ chain : use all peptides, not only first Sequence .pdb_files added to store information about pdb file for each ... monomers = monomers...

Еще в разделе: (Показать все результаты (>31650) - kodomo.fbb.msu.ru/ )

• allpy: 835efa2a8c71
• allpy: 835efa2a8c71 allpy/markups.py
• allpy: 3048f18154ef lib/sequence.py

A language for a tool set oriented to interactive processing of complex data structures" . Arushanian O.B., Bogomolov N.A., Kovalev A.D. A language for description of data and scenarios of their treatment is considered. The language is used in the framework of programming tools being developed at the Research Computing Center of Moscow State University to automize the creation of applications oriented to interactive processing of complex data structures. ... PostScript (in Russian) (810KB) . ...

Еще в разделе: (Показать все результаты (>355) - num-meth.srcc.msu.ru/ )

• "Solution of 3D nonviscous compressible gas equations on unstructured meshes
• "Enclosure structures of equal level line fields in the gradient filling
• "Routing on lattice-cellular structures"

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6964) - mouse.belozersky.msu.ru/ )

• Geometrical core
• S : 3D_of_rm_system_components
• S : rm_systems

THE POST-SIMPOSIUM EXCURSION ( July 31 - August 7,1998 ) . ... The six-day excursion took the participants from Lanzhou via the western loess hill country to the north-eastern Tibetan Plateau and via the West Quinling Mountains back to Lanzhou. ... This section is 39m thick and contains the loess of the last glacial period as well as a basal complex of flood loam. In the latter, three poorly developed Ah-horizons can be identified. ...

Еще в разделе: (Показать все результаты (>131) - www.fadr.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Jansen S. , Collins A. , Golden L. , Sokolova O. , Goode B.L. в журнале Journal of Biological Chemistry , издательство American Society for Biochemistry and Molecular Biology Inc. ... Maiti S., Michelot A., Gould C., Blanchoin L. , Sokolova O. , Goode B.L. в журнале Cytoskeleton , издательство John Wiley & Sons Inc. ...

Еще в разделе: (Показать все результаты (>5585) - istina.msu.ru/ )

• Frenkiel T.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Mach K. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Ikorskiy Vladimir N. - сотрудник | ИСТИНА - Интеллектуальная Система