... help . ... files . ... _cores/pair_cores.py Tue Jul 12 23:57:18 2011 +0400 1.3 @@ -8,88 +8,86 @@ 1.4 from copy import copy 1.5 1.6 from protein_pdb import Alignment , Block, Monomer, Sequence 1.7 -from allpy import processors 1.8 +from allpy import processors, markups 1.9 import allpy .base 1.10 from html import html_template 1.11 +from allpy .structure import CachedDownloadPdb, cached_download_pdb 1.12 1.13 -def remove_monomers_without_structure(block): 1.14 - monomers ...

Еще в разделе: (Показать все результаты (>112956) - kodomo.fbb.msu.ru/ )

• allpy: 1ce3b0e42ba5
• allpy: 211330654df7
• allpy: eb2a902b1e0a

SVETKA, a program for Analysis of Multiple Sequence Alignments . ... Analyse your alignment . ... Alignment . Nota Bene! .aln or .fasta format required!! Look here for comments . ... Nota Bene! Special scheme format required! ... Development of the program is supported by Ministry of Education and Science of the Russian Federation (State Contract No. ...

Еще в разделе: (Показать все результаты (>6987) - mouse.belozersky.msu.ru/ )

• Geometrical core
• S : rm_systems
• Example of alignment

Scoring Matrices . Matrix Sequences Sequence Consisting of the first four Amino Acids in the Protein GYRB_ECOL: . ... Sequence Achieved by Substitution of the 2nd and 4th Amino Acid and Insertion between the 3d and 4th Amino Acid, in the Protein GYRB_ECOLI, to randomly chosen new amino acids: . ... Matrix Sequences Sequence Consisting of the First Nine Amino Acids of the Protein GYRB_ECOLI: . ... Sequence Consisting of 2nd, 3d, 7th, 8th and 9th Amino Acid Residues of the Protein GYRB_ECOLI: . ...

Еще в разделе: (Показать все результаты (>5874) - kodomo.cmm.msu.ru/ )

• Changeset 112:2d048c0ed5e3 тАУ Python Battle
• Множественное выравнивание.
• Changeset 109:7352863453bc тАУ Python Battle

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>165) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Multiple alignment
• Bioinformatics portal, Moscow State University

. SVETKA, a program for Analysis of Multiple Sequence Alignments . Helps (useful info) . Analyse your alignment . Interesting . links . Our Country . loads for a long time! . Our City . Our University . Our Institute . Our seminar . Our project . Name (optional) . Alignment . Nota Bene! .aln or .fasta format required!!! . Look here for comments . Tree (optional) . Nota Bene! Special scheme format required! . Look here for comments .

Еще в разделе: (Показать все результаты (>1338) - monkey.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• SDP home page
• ETS sequence conservation

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt

Электронная библиотека Попечительского совета . ... Althaus E. - A branch-and-cut algorithm for multiple sequence alignment . ... Название: A branch-and-cut algorithm for multiple sequence alignment . Автор: Althaus E. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>3069) - lib.mexmat.ru/ )

• Lathrop R.H., Rogers Jr R.G., Smith T.F. - A Bayes-optimal sequence-structure
• Brown S.M. - Bioinformatics: A Biologist's Guide to Biocomputing and the
• Korf I., Yandell M., Bedell J. - Blast (Basic Local Alignment Search Tool) ::

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>237) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPpred
• SDPsite - Algorithm Format requirements

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>669) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - ClustalW
• SAL- Other Scientific Fields - Chemistry, Biology Related - DCSE
• SAL- Other Scientific Fields - Chemistry, Biology Related - HMMER

... TWikiMetaData . ... Meta Data Syntax . ... META:FORM . ... Additional topic data, program-generated or from TWikiForms , is stored in META variable name/value pairs . TWikiMetaData uses META variables to store topic data that's separate from the main free-form content. ... Use META variables to format and display Meta Data. Format is the same as in TWikiVariables , except all fields have a key. ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.TWikiMetaData . ...

Еще в разделе: (Показать все результаты (>30548) - dualopt1.cmm.msu.ru/ )

• TWikiMetaData - TWiki - TWiki - (printable)

Изучение статистики наиболее длинной общей подпослеовательности двух случайных подпоследовательностей является одной из самых интересных и трудных задач вычислительной математической биологии. В докладе будут представлены результаты, касающиеся статистического распределения общих подпоследовательностей в упрощенном (некоррелированном) варианте модели, т.наз. модели Бернулли . ...

Еще в разделе: (Показать все результаты (>64) - polly.phys.msu.ru/ )

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>385) - www.parallel.ru/ )

• Writing wrapper definitions | PARALLEL.RU - Информационно-аналитический центр
• Progress | PARALLEL.RU - Информационно-аналитический центр по параллельным

... Another way to fend off and detect impostors is to use call sequence checks. Call sequence checks help you protect against intruders that somehow managed to find out the password you log into your UUCP system with. ... When the attacker call your UUCP feed and steals your mail, this will increase the feeds call sequence number by one. ... If you have enabled call sequence checks, you should check your log files regularly for error messages that hint at possible attacks. ...

Еще в разделе: (Показать все результаты (>167) - itpm.msu.su/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Taylor & Francis . Местоположение издательства: United Kingdom . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены. обратная связь . Создать

Еще в разделе: (Показать все результаты (>432) - istina.msu.ru/ )

• Journal of Integer Sequences - журнал | ИСТИНА - Интеллектуальная Система
• Protein sequences & data analysis - журнал | ИСТИНА - Интеллектуальная Система
• METHOD FOR SIMULTANEOUSLY DETECTING A PLURALITY OF RNA SEQUENCES IN A

Next: Roche lobe overflow (stage Up: Principal Evolutionary States of Previous: Main-sequence stars (stage I) . ... The duration of this stage for a binary component is no longer a function of the stellar mass alone (as in the case of single stars), but also depends on the initial binary type (A, B or C) (Iben and Tutukov, 1985, 1987[ 74 , 75 ]): . The radius of the post-MS star rapidly increases (on a thermal time-scale)   and reaches characteristic giant values. ...

Еще в разделе: (Показать все результаты (>119) - xray.sai.msu.ru/ )

• Main-sequence stars (stage I)

Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit eutils flag-o-matic multilib toolchain-funcs EXTENSIONS = -without- extensions DESCRIPTION= Multiple sequence alignments using a variety of algorithms HOMEPAGE= http:// mafft .cbrc.jp/alignment/software/index.html SRC_URI= http:// mafft .cbrc.jp/alignment/software/${P}${ ...

Еще в разделе: (Показать все результаты (>14305) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/mafft/mafft-7.215.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/t-coffee/t-coffee-9.03.1318-r1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/bwa/bwa-0.7.12.ebuild

Astronomy Picture of the Day . La Palma Eclipse Sequence . ... Credit Copyright: Miguel Claro ( TWAN ) Explanation: At left, a dramatic image sequence follows late September's total lunar eclipse above a rugged landscape and sea of clouds from the Canary island of La Palma . Composited in a circular fisheye projection, the brightness of the Full Perigee Moon changes drastically in transition from outside the total eclipse phase compared to its dim glow during the 72 minute long totality . ...

Еще в разделе: (Показать все результаты (>3968) - www.astronet.ru/ )

• Bakasa Eclipse Sequence
• A Mercury Transit Sequence
• Alaska Aurora Sequence

. [ Войти ] . Главная -> Фильмы -> The Lost Spider Pit Sequence . Пользователи . Демо . Деньги . Фильмы . Форум . The Lost Spider Pit Sequence . Новая Зеландия 2005 . отметить . Фантастика . Ужасы . Триллер .

Еще в разделе: (Показать все результаты (>9) - kinfo.ru/ )

... LDAP is the Lightweight Directory Access Protocol, and is a protocol used to access "Directory Servers". ... Search surname entry $sr= ldap _ search ($ds, o=My Company, c=US , sn=S* ); echo Search result is .$sr. p ; echo Number of entires returned is . ldap _count_ entries ($ds,$sr). p ; echo Getting entries ... p ; $info = ldap _ get _ entries ($ds, $sr); ... ldap_get_attributes -- Get attributes from a search result entry . ... ldap_get_entries -- Get all result entries...

Еще в разделе: (Показать все результаты (>173) - oit.cmc.msu.ru/ )

• How Directory, Location and Files sections work
• Часть XIII - Структурированные типы
• imap_setflag_full