AliGraf - GeneBee Graphical Alignment Help Type in a title for this session for you to remember. ... Type in an alignment algorith name (Genebee, ClustalW, Manual.. ... Even - all column space are colored; Sparse - every column is colored with respect to the column weight: less weight more space is left uncolored; Very sparse - more space is left uncolored. ... Also you can get a picture when only selected groups are colored. ... Group set depends on selected group type. ...

Еще в разделе: (Показать все результаты (>118) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignment Comparison Help

... lib/project.py . ... 1.1 --- a/ lib / project .py Wed Nov 03 19:01:50 2010 +0300 1.2 +++ b/ lib / project .py Wed Nov 03 19:08:20 2010 +0300 1.3 @@ -33,9 +33,9 @@ 1.4 overloaded constructor 1.5 1.6 Project () - new empty Project 1.7 - Project ( sequences , alignment ) - new Project with sequences and 1.8 - alignment initialized from arguments 1.9 - Project (fasta_file) - new Project , read ...

Еще в разделе: (Показать все результаты (>25168) - kodomo.fbb.msu.ru/ )

• allpy: lib/project.py diff
• allpy: allpy/base.py diff
• allpy: f8bd7c469fcf

... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: features respective luxury the "popular", . ... a href=http://fretoileisabelmarant.webs.com/><b>isabe l marant</b></a> With one of these cheaps, it will be easy to locate the HERMES purses. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>925) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: the to respective diamonds
• Экологический Форум - Фундаментальная Экология: respective Hang various for

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus

... Block DNA GyrB" shows the score of pairs Lys|Lys, Lys|Arg and Lys|Ser respectively, from a block constituted by amino acid sequences from the same protein (DNAGyraseB), but from different organisms, for example GYRB_ECOLI, GYRB_YERPE (yeast), GYRB_HEINE, GYRB_MUSC (mouse). Block 200 illustrates the score of these pairs from 200 different blocks constituted by sequences from differnet organisms. ... Between the values of single BLock the differences are smaller than between the values of Blosum62. ...

Еще в разделе: (Показать все результаты (>1856) - kodomo.cmm.msu.ru/ )

• Global and Local Alignment of A.A Sequences
• Structure Alignment
• Multiple alignment

Geometrical core (core) is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chains. ... Minimal core size (#aa's) . ... Alternative core new atoms (%) . ... Geometrical core is a maximal set of alignment positions such that C atoms in these positions are disposed similarly in ALL input protein chain. ... Each input sequences is aligned to the corresponding sequence obtained from the ATOM section of the protein chain in the PDB file. ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

... There are many methods for reconstruction of phylogeny from multiple protein sequence alignments. ... In this work we tried to create expert systems that predict: 1) if the data is good for phylogeny reconstruction by Fitch ­ Margolish (FM) method; 2) which method would work better: FM or UPGMA. ... We used two species sets, first containing 27 Fungi species and second containing 25 Metazoa species. ... From the entire set of alignments, two subsets were extracted, called "good" and "bad". ...

Еще в разделе: (Показать все результаты (>118) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/167.pdf

... Sequence conservation . ... 7 PDB entries containing coordinates of HTH3 domains were used in this study. These entries represent 4 proteins from two bacteriphages: phage lambda and phage 434. ... Lambda C1 repressor . Bacteriophage lambda . ... 434 C1 repressor . ... Line Aligned shows whether the respective residues are aligned on structural alignment, A stands for aligned residues, L stands for second structure elements which are similarly arranged in space, but actually cannot be aligned. ...

Еще в разделе: (Показать все результаты (>240) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

... array snmpwalkoid ( string hostname, string community, string object_id [, int timeout [, int retries]]) . Returns an associative array with object ids and their respective object value starting from the object_id as root and FALSE on error. snmpwalkoid() function is used to read all object ids and their respective values from an SNMP agent specified by the hostname. ... A NULL object_id is taken as the root of the SNMP objects tree and all objects under that tree are returned as an array. ...

Еще в разделе: (Показать все результаты (>91) - oit.cmc.msu.ru/ )

• sesam_field_array
• gmp_gcdext
• sesam_num_fields

... The program calculates the correlation between each pair of columns [ i, j ]: one from the proteins alignment, and the other from the site alignment. As a measure of correlation, the mutual information is used: . ... Arrays of 20 aminoacids and 4 nucleotides respectively. Observed frequency of aminoacid x being in position i and nucleotide y being in position j . ... Calculated as frequency of aminoacid x in column i multiplied by frequency of nucleotide y in column j . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• Prot-DNA-Korr: main page
• Alignment example

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Электронная библиотека Попечительского совета . ... Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of Liquid Crystal Devices . ... Название: Alignment Technologies and Applications of Liquid Crystal Devices . Авторы: Takatoh K., Hasegawa M., Itoh N. Аннотация: . ... Alignment Technologies and Applications of Liquid Crystal Devices demonstrates both the fundamental and practical aspects of alignment phenomena in liquid crystals. ...

Еще в разделе: (Показать все результаты (>1496) - lib.mexmat.ru/ )

• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Schmidt O.G. - Lateral Alignment of Epitaxial Quantum Dots :: Электронная
• Hoque F. - The Alignment Effect: How to Get Real Business Value Out of

... Обувь sergio manchot . ... Отзывы об обуви Respect yourself в основном положительные. Помимо вышеуказанных основных четырех направлений, компания Respect yourself выпустила бренд под названием ?Respect Premium? основным отличительным знаком которого является производство обуви из кожи ?золотого класса?, а именно ската, угря, змеи, варана, крокодила и других животных. ... Каталог предлагает к рассмотрению ключевые четыре линии коллекции различной обуви. ... Respect обувь каталог харьков . ...

Еще в разделе: (Показать все результаты (>22) - sparallel.ru/ )

• Respect обувь каталог харьков | sparallel.ru
• admin | sparallel.ru - Part 291
• sparallel.ru - Part 291

Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit eutils flag-o-matic multilib toolchain-funcs EXTENSIONS = -without- extensions DESCRIPTION= Multiple sequence alignments using a variety of algorithms HOMEPAGE= http:// mafft .cbrc.jp/alignment/software/index.html SRC_URI= http:// mafft .cbrc.jp/alignment/software/${P}${ ...

Еще в разделе: (Показать все результаты (>14355) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/mafft/mafft-7.050.ebuild
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/poa/poa-2-r1.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc15.txt.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>48) - num-meth.srcc.msu.ru/ )

... Value: . length> | ... block-level elements . ... Example(s): . ... The color(s) required for the text decoration should be derived from the 'color' property value. ... Since no shadow color is specified for the third shadow effect, the value of the element's 'color' property will be used: H2 { text-shadow: 3px 3px red, yellow -3px 3px 2px, 3px -3px } . ... Here, the 'background' and 'color' properties have the same value and the 'text-shadow' property is used to create a "solar eclipse" effect: . ...

Еще в разделе: (Показать все результаты (>729) - crydee.sai.msu.ru/ )

• Long description for example illustrating positioning with respect to a
• Long description illustrating absolute positioning with respect to the initial
• Alignment, font styles, and horizontal rules in HTML documents

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>176) - rtm-cs.sinp.msu.ru/ )

• Trademarks
• Qt Toolkit - QBoxLayout Class
• Qt Toolkit - QLabel Class

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>58) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>17) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... Главная -> Фильмы -> Men of Respect . ... Фильмы . ... Men of Respect . ... John Turturro . ... Steven Wright . ... Michael Badalucco . Robert Modica . ... Michael Sergio . ... Joseph Carberry . John Gallagher . Richard Petrocelli . ... Steven Randazzo . Robert Moresco . ... Richard Spore . ... Joseph Ragno . ... Richard Grund . ... Michael Philip Del Rio . ...

Еще в разделе: (Показать все результаты (>21) - kinfo.ru/ )

• Sauf le respect que je vous .. - Фильмы - Kinfo.ru
• Respect - Пользователи - Kinfo.ru
• The Sopranos: Road to Respect - Фильмы - Kinfo.ru