... annotate . ... 3 This release collects a lot of changes that happened during half year . ... 8 * greatly improved markups support and markups IO . ... 12 * and a lot of work on ` blocks3d ` and ` pair_cores ` with many new features , . ... 39 * new : added ` MarkupIOMixin ` which simplifies defining savable markup classes . ... 40 * new : added pre - defined generic markups for simple data types ( int , char , . ... 69 * new : File format 'markup' for storing alignment with arbitrary markups . ...

Еще в разделе: (Показать все результаты (>113173) - kodomo.fbb.msu.ru/ )

• allpy: allpy/dna.py annotate
• allpy: allpy/rna.py annotate
• allpy: .hgignore annotate

... annotate . ... Automated merge with ssh://kodomo/petri_dish . ... Smirnova@1 . ... 2 def __init__ ( self , num , bacteria , radius , delta , bact_r , full_lifetime ): . ... 3 self . ... bacteria = bacteria . ... delta = delta . ... bact_r = bact_r . ... 10 def step ( self , delta_t , env ): . ... 11 for bact in self . bacteria : . ... 12 bact . lifetime -= delta_t . ... bacteria , delta_t , self . ... delta , self . bact_r , self . ... collision ( collide , delta_t , self . ...

Еще в разделе: (Показать все результаты (>5009) - kodomo.cmm.msu.ru/ )

• petri_dish: scale.py annotate
• petri_dish: Bacteria.py annotate
• petri_dish: tk1.py annotate

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6980) - mouse.belozersky.msu.ru/ )

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>95) - www.genebee.msu.ru/ )

• Genebee Predicted Annotation
• Genebee Predicted Annotation - Advanced

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>239) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus

Astronomy Picture of the Day . ... 11.11.1997 . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... November 1997 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: Galactic Center . Publications with words: Galactic Center . ... Sgr A*: Fast Stars Near the Galactic Center . ...

Еще в разделе: (Показать все результаты (>3234) - www.astronet.ru/ )

• Астронет > An Annotated Leonid
• Астронет > The Annotated Galactic Center

... Next . 3.0.12 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_add_annotation -- Adds annotation . void cpdf_add_annotation ( int pdf document, float llx, float lly, float urx, float ury, string title, string content [, int mode]) . The cpdf_add_annotation() adds a note with the lower left corner at ( llx , lly ) and the upper right corner at ( urx , ury ). The optional parameter mode determines the unit length. If it's 0 or omitted the default unit as specified for the page is used. ...

Еще в разделе: (Показать все результаты (>72) - oit.cmc.msu.ru/ )

• Java Distributed Computing course annotation
• pdf_add_annotation
• pdf_add_launchlink

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. September 11, 1999 . The Annotated Galactic Center . ... Constellations near the galactic center include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open star clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular star clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>242) - www.sai.msu.su/ )

• APOD: 2010 August 31 - The Annotated Galactic Center
• APOD: November 30, 1998 - An Annotated Leonid
• APOD: 2001 November 11 - An Annotated Leonid

... 2016, issue ? 1 : Annotation . ... 1 : Contents . 2015, issue ? ... 2014, issue ? ... 2013, issue ? ... 2012, issue ? ... 2011, issue ? ... 2010, issue ? ... 2009, issue ? ... 2008, issue ? ... Web-site of Russian Journal of Biological Invasions is developed and supported by the . Group of Bioinformatics and Modeling Biological Processes" IPEE RAS . ... Russian Journal of Biological Invasions . ...

Еще в разделе: (Показать все результаты (>445) - www.sevin.ru/ )

• Russian journal of biological invasions: Contents
• Russian Journal of Biological Invasions: 2012, issue ? 2
• Russian Journal of Biological Invasions: 2013, issue ? 1

SCIENTIFIC TASKS AND RESULTS . In the results of searching for new perspective solid state materials for the quantum electronics, non-linear optics and other fields of physics more than 200 various oxide compounds were synthesized and peculiarities of their atomic structure and physical properties are studied. Single crystals of 80 such the compounds are grown and thoroughly investigated. ... A family of oxide-ion conductors on the base of La 2 Mo 2 O 9 (30.10.09) . ... Main page ...

Еще в разделе: (Показать все результаты (>13) - polly.phys.msu.ru/ )

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1413) - lib.mexmat.ru/ )

• Поиск книг, содержащих BibTeX'овский стиль, annotate :: Электронная библиотека
• Friedman A., Klander L., Michaelis M. - C/C++ Annotated Archives :: Электронная
• Schilder F. (ed.), Katz G. (ed.), Pustejovsky J. (ed.) - Annotating, extracting

An annotated checklist of the insectivores (Mammalia, Lipotyphla) of Vietnam . Abramov A.V., Dang Ngoc Can, Bui Tuan Hai Nguyen Truong Son . P. 57-70 . An annotated checklist of 32 extant species from 12 genera of the insectivores (Mammalia, Lipotyphla) of Vietnam is provided. ...

Еще в разделе: (Показать все результаты (>250) - zmmu.msu.ru/ )

• Russian Journal of Theriology

... Second, alignment of highly similar genomic sequences is useful for comparison of genome assemblies of the same organism or closely related ones. ... Nucleotide pangenome (NPG) of an input set of genomes is a set of aligned blocks, each block composed of orthologous fragments. ... Hemi-stable blocks (h-blocks) include no more than one fragment of a genome and lack a fragment of at least one of genomes. ... Blocks with repeats (r-blocks) include more than one fragment from one or several genomes. ...

Еще в разделе: (Показать все результаты (>109) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/42.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/236.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>5) - www.arcetri.astro.it/ )

... 2016-Jan-25 18:28:49 . ... application/octet-stream . ... 1.8K . text/plain . ... text/xml . ...

Еще в разделе: (Показать все результаты (>6096) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-java/jackson-annotations/
• Index of /pub/gentoo-portage/dev-java/jcip-annotations/
• Index of /pub/gentoo-portage/dev-java/myfaces-builder-annotations/

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

Confusion is Sex - Annotated ---------------------------- (She's In A) Bad Mood --------------------- Protect Me You -------------- Freezer Burn ------------ I Wanna Be Your Dog ------------------- The original lyrics are from a song on The Stooge's first self-titled album , released on Elektra Records in 1969 , written by Iggy Stooge: So messed up, I want you here In my room, I want you here Now we're gonna be face-to-face And we ...

Еще в разделе: (Показать все результаты (>1129) - crydee.sai.msu.ru/ )

• ApSA courses
• Long description of example illustrating table row height calculations and

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• SDPlight
• Alignment example
• SDPpred

1) Faculty of Soil Science, Moscow State University, Moscow 119899, Russia; . ... We assessed critical loads of acid deposition and their exceedance for soils in the Kola Peninsula using a simple balance method and mapped them within 1.0° · 0.5° longitude/latitude grid cells. ... Terrestrial ecosystems in the north-western Kola Peninsula are particularly susceptible to acid deposition damage due to relatively high soil sensitivity and heavy sulphur deposition. back . ...

Еще в разделе: (Показать все результаты (>27) - eco.soil.msu.ru/ )

• EFFECTS OF ACID DEPOSITION ON ACIDITY IN PODZOLS
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• SIMULATION OF ACID SNOW AND RAIN IMPACT ON FORESTS