... Html template files and path to imported module can be passed on the command line. In the imported module can be function "init" which takes an alignment for adding some attributes after alignment is loaded. author . ... 1 * new : add an argument not to save downloaded pdb ( CachedDownloadPdb ) . ... 3 * new : allow to load custom pdbs ( allpy . ... 8 * new: add method blocks_from_homology() (allpy.structure) . 9 * new: add MonomerHomology-based high blocks building algo to pair-cores . ...

Еще в разделе: (Показать все результаты (>36104) - kodomo.fbb.msu.ru/ )

• allpy: NEWS annotate
• allpy: df571a5233fb
• allpy: df571a5233fb test/usecase1.py

... Vertical alignment of header cells; overrides valign . unspecified . ... Vertical alignment of cells and headers, set to "top" , "middle" , "bottom" or "baseline" . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). unspecified . ... Header cell text colour. "#ffffff" . ...

Еще в разделе: (Показать все результаты (>28280) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki - (printable)
• VarTABLE - TWiki - TWiki

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>120) - uneex.lorien.cs.msu.su/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>41) - uneex.mithril.cs.msu.su/ )

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>3715) - wiki.cmc.msu.ru/ )

Network Working Group Request for Comments: 1464 R. Rosenbaum Digital Equipment Corporation May 1993 Using the Domain Name System To Store Arbitrary String Attributes Status of this Memo This memo defines an Experimental Protocol for the Internet community. ... Abstract While the Domain Name System (DNS) [2,3] is generally used to store predefined types of information (e.g., addresses of hosts), it is possible to use it to store information that has not been previously classified. ...

Еще в разделе: (Показать все результаты (>12128) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1464.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5543.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1997.txt

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>68) - comet.sai.msu.ru/ )

• Paragraphs
• Horizontal Tabs
• HTML Math

Электронная библиотека Попечительского совета . ... Eckstein R., Spainhour S. - Webmaster in a Nutshell . ... Название: Webmaster in a Nutshell . Авторы: Eckstein R., Spainhour S. Аннотация: . Webmaster in a Nutshell is a concise and portable quick reference guide that distills an immense amount of information on several languages and technologies into one compact book. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>2444) - lib.mexmat.ru/ )

• Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of
• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Sells C., Weinhardt M., Boulter M. - Windows Forms 2.0 Programming ::

previous next contents elements attributes index . ... Alignment . ... Font style elements: the TT , I , B , BIG , SMALL , STRIKE , S , and U elements . ... This attribute specifies the horizontal alignment of its element with respect to the surrounding context. ... You could reduce the scope of the style by setting the class attribute on the element: <HEAD> <TITLE>How to Carve Wood</TITLE> <STYLE type="text/css"> H1.wood {text-align: center} </STYLE> <BODY> <H1 class="wood"> How to Carve Wood </H1> . ...

Еще в разделе: (Показать все результаты (>484) - crydee.sai.msu.ru/ )

• Index of the HTML 4.0 Attributes
• Conformance: requirements and recommendations

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus

... Font style elements: the TT , I , B , BIG , SMALL , STRIKE , S , and U elements . ... This attribute specifies the horizontal alignment of its element with respect to the surrounding context. ... ELEMENT FONT - - ( %inline; )* -- local change to font --> <!ATTLIST FONT %coreattrs; -- id , class , style , title -- size CDATA #IMPLIED -- [+]nn e.g. size="+1", size=4 -- color CDATA #IMPLIED -- #RRGGBB in hex, e.g. red: "#FF0000" -- face CDATA #IMPLIED -- comma separated list of font names -- > . ...

Еще в разделе: (Показать все результаты (>116) - itpm.msu.su/ )

• Changes between HTML 3.2 and HTML 4.0
• Definitions and Conventions
• Index of the HTML 4.0 Attributes

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6987) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>256) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

... HELP ON SCREENING OF PATTERN OR ALIGNMENT AGAINST PROTEIN PROTEIN . ... The method of looking for all pattern entries (possibly inexact) in PROTEIN databank is almost the same as in PROSITE screening procedure. ... The screening by query alignment, based on the same principle: the alignment is seen as a pattern defining letter's frequencies in every position. The pattern example: . ... the only one capital letter at a position means that only given residue should be at the position. ...

Еще в разделе: (Показать все результаты (>113) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee

... Attributes . ... This requires that attributes be tagged either as ``C,'' ``C++'' or ``Fortran,'' and that the language tag be checked in order to use the right calling convention for the callback function. ... The attribute manipulation functions described in Section 5.7 of the MPI-1 standard define attributes arguments to be of type void* in C, and of type INTEGER, in Fortran. ... Fortran attribute functions put and get integer valued attributes. ... A. C to Fortran . ... Fortran code . ... Центры...

Еще в разделе: (Показать все результаты (>220) - www.parallel.ru/ )

• Window Attributes | PARALLEL.RU - Информационно-аналитический центр по
• Clarification of Error Behavior of Attribute Callback Functions | PARALLEL.RU -
• New Attribute Caching Functions | PARALLEL.RU - Информационно-аналитический

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>54) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

PHP Manual . Prev . Next . PHP 4 >= 4.0.0) domxml_attributes -- Returns an array of attributes of a node . array domxml_attributes ( resource node) . ... This function is EXPERIMENTAL . The behaviour of this function, the name of this function, and anything else documented about this function may change in a future release of PHP without notice. Be warned and use this function at your own risk. Returns all attributes of a node as array of objects of type "dom attribute". ...

Еще в разделе: (Показать все результаты (>620) - oit.cmc.msu.ru/ )

• domxml_set_attribute
• domxml_get_attribute
• ldap_get_attributes

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

Scoring Matrices . Matrix Sequences Sequence Consisting of the first four Amino Acids in the Protein GYRB_ECOL: . ... Sequence Achieved by Substitution of the 2nd and 4th Amino Acid and Insertion between the 3d and 4th Amino Acid, in the Protein GYRB_ECOLI, to randomly chosen new amino acids: . ... Matrix Sequences Sequence Consisting of the First Nine Amino Acids of the Protein GYRB_ECOLI: . ... Sequence Consisting of 2nd, 3d, 7th, 8th and 9th Amino Acid Residues of the Protein GYRB_ECOLI: . ...

Еще в разделе: (Показать все результаты (>2136) - kodomo.cmm.msu.ru/ )

• Structure Alignment
• Alignment
• Multiple alignment

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster