Next: The Scenario Machine: Operational Up: Evolution of Magnetic Rotators Previous: Ejector-propeller hysteresis . ... The length of this segment is determined by the eccentricity. ... In this case no hysteresis occurs and transitions E -- P and the reverse take place in symmetrical points of the orbit. ... Here EP means a mixed state of the rotator at which it is in the ejector state during one part of the orbit, and in the propeller state during the rest of the orbital cycle. ...

Еще в разделе: (Показать все результаты (>442) - xray.sai.msu.ru/ )

• Introduction
• Mergingology

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>52) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...

This layer is defined with a <LAYER> tag. You see that the background image is applied to the rectangular region occupied by the layer. The height of the filled-in area is determined by the height value. ... The style definition sets the background-image property. The height of the filled-in area is determined by the actual content. ... The style definition also includes a value for border-width and border color. ... The style definition includes a value for layer-background-image. ...

Еще в разделе: (Показать все результаты (>2427) - crydee.sai.msu.ru/ )

• Long description of example illustrating background calculation
• Introduction
• Different Fortran standards

... The CO2 laser-induced multiphoton dissociation (MPD) of C3H5X(CH3)3 molecules (X = C or Ge) in the gas phase was studied. ... It was shown that shortening of laser pulse (under the constant laser energy) decreases E only for molecules with atom Ge. The dependence of fragmentation probability of X(CH3)3, formed from MPD of C3H5X(CH3)3, on the laser fluence was found to be different for molecules with C or Ge. ...

Еще в разделе: (Показать все результаты (>697) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the
• Moscow University Chemistry Bulletin Vol. 53, No. 6, P. 405 (2012)
• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 274 (2008)

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>50) - monkey.belozersky.msu.ru/ )

• SDPpred

... April 6, 1996 . Andromeda Nebula: Var! ... Wilson Observatory's 100 inch telescope, Edwin Hubble determined the distance to the Andromeda Nebula - decisively demonstrating the existence of other galaxies far beyond the Milky Way . ... Identifying such a star allowed Hubble to show that Andromeda was not a small cluster of stars and gas within our own galaxy, but a large galaxy in its own right at a substantial distance from the Milky Way. ... About APOD | ...

Еще в разделе: (Показать все результаты (>8467) - www.sai.msu.su/ )

• APOD: 2000 December 30 - A Year of Resolving Backgrounds
• APOD: 2000 November 9 - The Cosmic X-Ray Background
• APOD: 2013 March 25 - Planck Maps the Microwave Background

... The goal of our work was to study the particularities of the flower behavior of Nymphaea candida L. To reach this goal we marked these problems: . 1)To study the dynamics of the behavior of Nymphaea candida flowers. 2)To find the factors which cause the rhythmic behavior of the flowers and intensity of the bloom of Nymphaea candida . ... 4)To compare published material on biological rhythms of different plant species with our material on the behavior of Nymphaea candida flowers. ...

Еще в разделе: (Показать все результаты (>192) - herba.msu.ru/ )

• Behaviour of white water-lily flowers in different photoperiods
• The variability of different Drosera
• Stability of leaf form and size during herbarization

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... Adding Dependency Information to a Package . ... When a package is built by RPM, if any file in the package's %files list is a shared library, the library's soname is automatically added to the list of capabilities the package provides. ... RPM uses two scripts to handle automatic dependency processing. ... Since the libc package includes, among others, the shared library /lib/libc.so.5.3.12 , RPM would obtain its soname. ...

Еще в разделе: (Показать все результаты (>338) - uneex.lorien.cs.msu.su/ )

• perchild - Apache HTTP Server
• Different Places an rpmrc File Resides
• alike. different.

Laboratories \ Laboratory for The Sensory Systems of Vertebrates \ Goals and Tasks . Goals and Tasks . ... Electrophysiological Laboratory at the Utrish Marine Station . ... In the field of cetaceans hearing research: . ... Acuteness of the frequency selectivity (quality of the filters canals in the auditory system) in different species of dolphins constitutes the range of 30 to 50 that is 3-5 times higher than in most terrestrial mammals (excluding bats) and humans (about 10). ...

Еще в разделе: (Показать все результаты (>4093) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: the to style determined day,
• Экологический Форум - Фундаментальная Экология: by way of a different problem
• Экологический Форум - Фундаментальная Экология: different wearers relating to

... An iterative method for determining the shape and conductivity of a homogeneous inclusion in the two-dimensional electrical impedance tomography problem" . Gavrilov S.V. The problem of electrical impedance tomography in a bounded two-dimensional domain with a piecewise two-valued constant electrical conductivity is considered. ... Keywords: electrical impedance tomography, piecewise constant conductivity, iterative method, Tikhonov regularization method. ...

Еще в разделе: (Показать все результаты (>201) - num-meth.srcc.msu.ru/ )

• "Shock waves in real gases with different specific heat ratios ahead of and
• "Mathematical simulation of creep processes in metal patterns made of materials
• "Numerical conditioning analysis of two-dimensional problems in electrical

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>186) - graphics.cs.msu.ru/ )

• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа
• Semiautomatic Visual-Attention Modeling | Graphics and Media Lab
• Semiautomatic Visual-Attention Modeling | Лаборатория компьютерной графики и

Biochemical analysis of the metabolism of small rodents living in different radioecological conditions . ... The initial differences of metabolism and their modification under the conditions of radioactive pollution of the environment are presented on the basis of the complex of biochemical parameters of two ecologically different species of small rodents ( Apodemus uralensis and Myodes rutilus ). ...

Еще в разделе: (Показать все результаты (>1168) - zmmu.msu.ru/ )

• Epigenetic variation of the common shrew, Sorex araneus, in different habitats

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>4) - swx.sinp.msu.ru/ )

... Description of the model of a minimal interaction of a gravity with scalar matter fields. ... Separation of equations for the physical degrees of freedom (a specially chosen gauge). ... Branon mass spectrum in the theory with a potential . Asymmetric background solutions and the defect of the cosmological constant. ... Generation of asymmetric brane Two scalar doublets Mass spectrum equation Solution even function odd function ( ( FL0) + FL1 ) provides an asymmetric brane localization for fermions ...

Еще в разделе: (Показать все результаты (>161) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/HiggsTalk_FINAL4.pdf
• http://qfthep.sinp.msu.ru/talks/ginzbbdark100912.pdf
• http://qfthep.sinp.msu.ru/talks2011/Libanov_Neutrino.pdf

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>9) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Algorithm Format requirements

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>86) - biochem.bio.msu.ru/ )

• Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling
• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of

... Keeping Time . ... The date command shows the current date and time. 1] For example: $ date Sun Jul 14 21:53:41 EET DST 1996 $ That time is Sunday, 14th of July, 1996 , at about ten before ten at the evening, in the time zone called ``EET DST'' (which might be East European Daylight Savings Time ). date can also show the univeral time : $ date -u Sun Jul 14 18:53:42 UTC 1996 Sun Jul 14 18:53:42 UTC 1996 $ date is also used to set the kernel's software clock : # ...

Еще в разделе: (Показать все результаты (>341) - itpm.msu.su/ )

• perchild - Apache HTTP Server
• Overview of the Directory Tree
• Message Routing and Delivery

Astronomy Picture of the Day . ... The different colors of this planetary nebula are determined by small differences in its composition. This bipolar nebula will continue to shine brightly for only a few thousand more years, after which its central star will fade and become a white dwarf star. ... Publications with keywords: bipolar - planetary nebula - butterfly nebula . Publications with words: bipolar - planetary nebula - butterfly nebula . ... NGC 3132: The Eight Burst Nebula . ...

Еще в разделе: (Показать все результаты (>8632) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > NGC 6302: The Butterfly Nebula
• An Orion of a Different Color

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>155) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis
• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help

Subdeletion structures as additional evidence for different analysis of synthetic and analytic comparatives in Russian In Russian there are two seemingly interchangeable comparative forms of adjectives: synthetic (the suffix -ee) and analytic (the word bolee). ... One more peculiar characteristic pertaining to synthetic rather than analytic comparatives in Russian is the inability of the former to appear in so-called subdeletion structures. ... Masa vyse Vani. i(analytic+GEN). ... Pancheva, Roumyana. ...

Еще в разделе: (Показать все результаты (>259) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/steriopolo.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/brykina.pdf