1. About authors ot this complex
... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...
[
]
http://mouse.belozersky.msu.ru/tools/svetka/articles/brancriteria.html -- 13.5 -- 09.06.2006
[
]
http://monkey.belozersky.msu.ru/~dian/svetka/articles/brancriteria.html -- 13.5 -- 09.06.2006
:
(
(>1436) - monkey.belozersky.msu.ru/ )
2. Shan Y., Yang A. - Applications of Complex Adaptive Systems ::
. ... Shan Y., Yang A. - Applications of Complex Adaptive Systems . ... : Applications of Complex Adaptive Systems . : Shan Y., Yang A. : . ... To fully understand these systems, complex adaptive systems research uses systemic inquiry to build multi-level and multidisciplinary representations of reality to study these systems. ... , 2004-2016 . ...
[
]
http://lib.mexmat.ru/books/79384 -- 15.0 -- 11.04.2016
:
(
(>7940) - lib.mexmat.ru/ )
3. NPIDB: 5DPK structure
... 5DPK structure . Page of complex: 5DPK . Home Browse Download Help About Us . ... PDB ID . ... MUTY ADENINE GLYCOSYLASE BOUND TO A TRANSITION STATE ANALOG (1N) PAIRED WITH D(8-OXOG) IN DUPLEXED DNA TO 2.2 A . ... View in . ... Protein chains: . DNA chains: . ... 5dpk.pdb1.pdb . ... Pfam domains . ... Download file with secondary structure created by Stride . 5dpk.pdb1.pdb: [ download sequences in FASTA format ] . ... Click "SHOW" for view sequence . ... NPIDB team 2003 - 2016 . ...
[
]
http://npidb.belozersky.msu.ru/complex/clist.html -- 33.2 -- 09.04.2016
:
(
(>18) - npidb.belozersky.msu.ru/ )
4. SAL- Other Scientific Fields - Chemistry, Biology Related - Sequin
Sequin . Sequin is a program designed to aid in the submission of sequences to the GenBank, EMBL, and DDBJ sequence databases. ... http://www.ncbi.nlm.nih.gov/Sequin/ . ... Other Packages: Yes, ftp://ncbi.nlm.nih.gov/sequin/ . ... None . ... ftp://ncbi.nlm.nih.gov/sequin/ . ... User Comments: . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . Comments? SAL@KachinaTech.COM . Copyright 1995-2001 by Herng-Jeng Jou . ...
[
]
http://www.sai.msu.su/sal/Z/2/SEQUIN.html -- 3.5 -- 22.12.2007
:
(
(>1667) - www.sai.msu.su/ )
5. MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...
[
]
http://itpm.msu.su/mysql/Manual_chapter/manual_Regexp.html -- 9.7 -- 15.02.2000
:
(
(>117) - itpm.msu.su/ )
6. Align tool for DNA-protein complexes
. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016
[
]
http://mouse.genebee.msu.ru/tools/StructAlign.html -- 5.0 -- 03.03.2016
:
(
(>31) - mouse.genebee.msu.ru/ )
7. Moscow University Chemistry Bulletin Vol. 52, No. 2, P. 99 (2011)
Previous article . Next article . ... Modeling calcium binding at the light harvesting complex of the bacterial photosynthetic center of Thermochromatium tepidum . ... Moscow University Chemistry Bulletin . 2011, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...
[
]
http://www.chem.msu.ru/eng/journals/vmgu/112/abs003.html -- 8.5 -- 28.02.2014
[
]
http://chem.msu.ru/eng/journals/vmgu/112/abs003.html -- 8.5 -- 10.04.2016
:
(
(>560) - chem.msu.ru/ )
8. http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf
... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...
[
]
http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf -- 393.6 -- 15.06.2015
:
(
(>286) - mccmb.belozersky.msu.ru/ )
9. http://geo.web.ru/conf/alkaline/2009/Asavin2.htm
The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...
[
]
http://geo.web.ru/conf/alkaline/2009/Asavin2.htm -- 110.8 -- 23.05.2009
:
(
(>514) - geo.web.ru/ )
10. > ,
... | ... | ... . ... . ... : . ... : . ... : , . ... - PDF, . ...
[
]
http://www.astronet.ru/db/map+/?complex_form=1&lang=ru -- 33.7 -- 13.02.2011
:
(
(>7148) - www.astronet.ru/ )
11. DNA-Protein complexes
... ..... 2'- . ... CB CYS 2983 chain L SG CYS 2983 chain L NH1 ARG 2082 chain L NZ LYS 2075 chain L NH1 ARG 882 chain K CB CYS 683 chain J SG CYS 683 chain J NH1 ARG 682 chain J SG CYS 483 chain I NH1 ARG 482 chain I CB CYS 283 chain H SG CYS 283 chain H NH1 ARG 282 chain H NZ LYS 275 chain H CE LYS 275 chain H . ... . ... IRF . ... , ARG 882 chain K . ...
[
]
http://kodomo.cmm.msu.ru/~nasting/term3/block2/DNA_protein.html -- 10.7 -- 20.12.2006
:
(
(>4112) - kodomo.cmm.msu.ru/ )
12. Intelligent Systems :: Research :: :: Articles
... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...
[
]
http://www.intsys.msu.ru/en/invest/speech/articles/lexers.htm -- 12.6 -- 09.04.2016
:
(
(>46) - www.intsys.msu.ru/ )
13. Complex evaluator
CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...
[
]
http://astrometric.sai.msu.ru/~symbol/calcsym.html -- 2.6 -- 06.10.2004
:
(
(>6) - astrometric.sai.msu.ru/ )
14. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
Construction of sequences of zeros and ones with complex finite sequences / A. Yu. ... Vestnik Moskovskogo Universiteta. Seriya 1. ... We construct infinite sequences of zeros and ones under some restrictions (not to contain subwords of some definite type or definite bits at definite positions, etc.) This paper concerns probabilistic methods of constructing such sequences with application of Lov sz lemma and their reformulation in terms of the Kolmogorov complexity and Martin-L f randomness. ...
[
]
http://vestnik.math.msu.su/en/DATA/2010/1/node7 -- 6.1 -- 10.04.2016
:
(
(>52) - vestnik.math.msu.su/ )
15. Example of alignment
Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...
[
]
http://mouse.genebee.msu.ru/tools/LCexample.html -- 2.3 -- 20.06.2015
[
]
http://mouse.belozersky.msu.ru/tools/LCexample.html -- 2.3 -- 20.06.2015
:
(
(>6961) - mouse.belozersky.msu.ru/ )
16. THE POST-SIMPOSIUM EXCURSION (July 31 - August 7,1998)
THE POST-SIMPOSIUM EXCURSION ( July 31 - August 7,1998 ) . ... The six-day excursion took the participants from Lanzhou via the western loess hill country to the north-eastern Tibetan Plateau and via the West Quinling Mountains back to Lanzhou. ... This section is 39m thick and contains the loess of the last glacial period as well as a basal complex of flood loam. In the latter, three poorly developed Ah-horizons can be identified. ...
[
]
http://www.paleopedology.msu.ru/nl-15/excursion2.htm -- 7.7 -- 26.11.2007
[
]
http://www.fadr.msu.ru/inqua/nl-15/excursion2.htm -- 7.7 -- 09.02.1999
:
(
(>104) - www.fadr.msu.ru/ )
17. COMPLEX
Gnumeric . Prev . Next . ... COMPLEX(real,im[,suffix]) . ... @suffix 'i' 'j', COMPLEX #VALUE!. Excel. COMPLEX(1,-1) 1-i. Prev . ... COMBIN . ... CONCATENATE ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r2105.html -- 3.9 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r2105.html -- 3.9 -- 26.09.2011
:
(
(>130) - uneex.lorien.cs.msu.su/ )
18. Molecular mechanics study of the mixed-ligand lanthanide complexes using
... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...
[
]
http://analyt.chem.msu.ru/preconcentration/pletnev/papers/acs2ka/acs2ka.html -- 7.0 -- 25.11.2006
:
(
(>31) - analyt.chem.msu.ru/ )
19. Heterooligomeric complexes formed by human small heat shock proteins HspB1
... Heterooligomeric complexes formed by human small heat shock proteins HspB1 (Hsp27) and HspB6 (Hsp20). ... Formation of heterooligomeric complexes of human small heat shock proteins (sHsp) HspB6 (Hsp20) and HspB1 (Hsp27) was analyzed by means of native gel electrophoresis, analytical ultracentrifugation, chemical cross-linking and size-exclusion chromatography. ... Inside of heterooligomeric complexes HspB6 inhibits phosphorylation of HspB1 by MAPKAP2 kinase. ...
[
]
http://www.biochem.bio.msu.ru/publications/publication.php?pubmedID=19100870 -- 4.8 -- 02.02.2013
[
]
http://biochem.bio.msu.ru/publications/publication.php?pubmedID=19100870 -- 4.8 -- 02.02.2013
:
(
(>102) - biochem.bio.msu.ru/ )
20. http://www.mce.biophys.msu.ru/archive/doc16002/doc.pdf
ESTIMATING THE LOCATION OF CHANGE-POINTS IN DNA SEQUENCES VIA THE CROSS-ENTROPY METHOD Sofronov G.Yu., ... We model the problem as a multiple change-point problem, that is, a problem in which sequential data is separated into segments by an unknown number of change-points, with each segment supposed to have been generated by a different process. ... We use the Cross-Entropy method to find estimates of change-points as well as parameters of the process on each segment. ...
[
]
http://www.mce.biophys.msu.ru/archive/doc16002/doc.pdf -- 28.1 -- 26.11.2007
:
(
(>129) - www.mce.biophys.msu.ru/ )