S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>6942) - monkey.belozersky.msu.ru/ )

• About authors ot this complex
• Molecular biology databases
• S publications

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>37) - mouse.genebee.msu.ru/ )

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7217) - lib.mexmat.ru/ )

• Thron W. - Introduction to the theory of functions of a complex variable ::
• Loday J.-L. - Cyclic Homology :: Электронная библиотека попечительского совета
• Wall C.T.C. - Surgery on compact manifolds :: Электронная библиотека

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>18) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure
• NPIDB: List of complexes

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>318) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/155.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/37.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/30.pdf

... 1r8e-mmmol.pdb содержит в 2 раза больше белка и ДНК двуцепочечную. ... base - все атомы оснований ДНК (эквивалентно dna and not backbone); . ... Определила множества полярных и неполярных атомов ДНК. ... define dr_p *.o?* and dna . ... полярные атомы остатков фосфорной кислоты . ... С помощью команды select within( < порог расстояния >, < множество > ) , определила количество атомов белка, образующих контакты каждого типа: . ... В таблице указано количество атомов белка, участвующх в контактах. ...

Еще в разделе: (Показать все результаты (>5969) - kodomo.cmm.msu.ru/ )

• DNA-protein complex
• Task 9 (DNA-Protein complexes)

... Heterooligomeric complexes formed by human small heat shock proteins HspB1 (Hsp27) and HspB6 (Hsp20). ... Formation of heterooligomeric complexes of human small heat shock proteins (sHsp) HspB6 (Hsp20) and HspB1 (Hsp27) was analyzed by means of native gel electrophoresis, analytical ultracentrifugation, chemical cross-linking and size-exclusion chromatography. ... Inside of heterooligomeric complexes HspB6 inhibits phosphorylation of HspB1 by MAPKAP2 kinase. ...

Еще в разделе: (Показать все результаты (>136) - biochem.bio.msu.ru/ )

• Heterooligomeric complexes of human small heat shock proteins.
• Oligomeric adiponectin forms and their complexes in the blood of healthy donors
• NADH/NAD+ interaction with NADH: ubiquinone oxidoreductase (complex I).

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>11963) - mouse.belozersky.msu.ru/ )

• S : 3D_of_rm_system_components
• MTPro
• PDB entries containing domains of the family "RNA dependent RNA polymerase"

AFM OF RNA AND RNA-PROTEINS COMPLEXES . ... TMV RNA-MP complexes and RNA protruded from partly uncoated TMV particles can be visualized on freshly cleaved mica . Length distribution of denatured TMV RNA visualized on mica has 3 peaks: 0.7 microns, 1.4 microns and 2.0 microns . The structure of TMV RNA-MP complexes depends on RNA:MP molar ratio, which is in "beads-on-a-string" and "thick string" conformations at the MP:RNA molar ratio of 20:1 and 60:1 respectively. ...

Еще в разделе: (Показать все результаты (>71) - www.spm.genebee.msu.ru/ )

• INTAS-01-0045
• DNA-surfactant complexes in organic media
• Proteins and membranes

Sequin . Sequin is a program designed to aid in the submission of sequences to the GenBank, EMBL, and DDBJ sequence databases. ... http://www.ncbi.nlm.nih.gov/Sequin/ . ... Other Packages: Yes, ftp://ncbi.nlm.nih.gov/sequin/ . ... None . ... ftp://ncbi.nlm.nih.gov/sequin/ . ... User Comments: . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . Comments? SAL@KachinaTech.COM . Copyright 1995-2001 by Herng-Jeng Jou . ...

Еще в разделе: (Показать все результаты (>1240) - www.sai.msu.su/ )

• SAL- Numerical Analysis - Misc - Radix-2 Fast Fourier Transform
• APOD: 2012 December 19 - NGC 5189: An Unusually Complex Planetary Nebula
• APOD: 2008 March 27 - The N44 Complex

... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...

Еще в разделе: (Показать все результаты (>96) - itpm.msu.su/ )

• Be Paranoid-- Call Sequence Checks

... Ольга . ... Екатерина . ... Дарья . ... Анастасия . ... Алексей . ... Анна . ...

Еще в разделе: (Показать все результаты (>33901) - kodomo.fbb.msu.ru/ )

• Task 9 (DNA-Protein complexes)
• allpy: df571a5233fb allpy/protein.py
• allpy: df571a5233fb

Previous article . Next article . ... Modeling calcium binding at the light harvesting complex of the bacterial photosynthetic center of Thermochromatium tepidum . ... Moscow University Chemistry Bulletin . 2011, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>698) - chem.msu.ru/ )

• Silicas modified by polyelectrolyte complexes for the ion chromatography of
• Molecular design of polydentate complexing agents: from topological analysis to
• Separation selectivity of anionic metal complexes of

... Астронет | ... Карта неба | ... Поле зрения . ... Размер карты . ... Предельная звездная величина: . ... Размер карты: примерный размер звездной карты в пикселях. ... Подписывать звездные величины: если установить данный флажок и задать пределы, на карте рядом со звездами соответствующего диапазона яркостей будут отбражаться их звездные величины без десятичной точки. ... Версия для печати - используйте эту ссылку для получения звездной карты в формате PDF, пригодном для высококачественной печати. ...

Еще в разделе: (Показать все результаты (>3151) - www.astronet.ru/ )

• Dusty Nebulae in Taurus
• Journal "Peremennye Zvezdy"
• A Twisted Solar Eruptive Prominence

LABORATORY OF NUCLEIC ACID-PROTEIN INTERACTIONS . ... Study of Natural Covalent Complexes of Nucleic Acids and Proteins . ... High sensitive tools and methods are developed in the laboratory for detection and identification of the viral and cellular nucleic acids and covalent complexes of RNA and proteins that contain the covalent linkage unit (CLU), which is identical to the CLU of the picornavirus VPg-RNA covalent complex. ... Antibodies against picornavirus RNA-VPg covalent linkage unit . ...

Еще в разделе: (Показать все результаты (>245) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• Databases
• Notes on searching by similarity

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>495) - geo.web.ru/ )

• Sudbury Igneous Complex
• Dictionary_M
• Второе приглашение на научно-практическую конференцию "Современные методы

ESTIMATING THE LOCATION OF CHANGE-POINTS IN DNA SEQUENCES VIA THE CROSS-ENTROPY METHOD Sofronov G.Yu., ... We model the problem as a multiple change-point problem, that is, a problem in which sequential data is separated into segments by an unknown number of change-points, with each segment supposed to have been generated by a different process. ... We use the Cross-Entropy method to find estimates of change-points as well as parameters of the process on each segment. ...

Еще в разделе: (Показать все результаты (>139) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc57352/doc.pdf

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>39) - www.intsys.msu.ru/ )

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>6) - astrometric.sai.msu.ru/ )

Construction of sequences of zeros and ones with complex finite sequences / A. Yu. ... Vestnik Moskovskogo Universiteta. Seriya 1. ... We construct infinite sequences of zeros and ones under some restrictions (not to contain subwords of some definite type or definite bits at definite positions, etc.) This paper concerns probabilistic methods of constructing such sequences with application of Lov sz lemma and their reformulation in terms of the Kolmogorov complexity and Martin-L f randomness. ...

Еще в разделе: (Показать все результаты (>47) - vestnik.math.msu.su/ )