Nucleotide sequence of the bioH gene of Escherichia coli" . ... The complete genome sequence of Escherichia coli K-12' . ... The 4,639,221-base pair sequence of Escherichia coli K-12 is presented. ... Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110' . ... With the goal of solving the whole-cell problem with Escherichia coli K-12 as a model cell, highly accurate genomes were determined for two closely related K-12 strains, MG1655 and W3110. ...

Еще в разделе: (Показать все результаты (>8672) - kodomo.cmm.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>7084) - monkey.belozersky.msu.ru/ )

• SDPpred
• HTH3_numeration_assumed
• Yeast intein-encoded LAGLIDADG homing endonucleases

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>144) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPsite - Algorithm Format requirements

... allpy/base.py sequence_based_blocks_search/blocks_finder.py . ... 2.1 --- a/ sequence _based_blocks_search/blocks_finder.py Fri Oct 28 20:40:55 2011 +0300 2.2 +++ b/ sequence _based_blocks_search/blocks_finder.py Tue Mar 20 22:08:55 2012 +0400 2.3 @@ -4,11 +4,46 @@ 2.4 sys.path.append( ../ ) 2.5 from allpy import protein 2.6 from allpy .homology import * 2.7 +from allpy import data 2.8 +from allpy import base 2.9 import copy 2.10 import math 2.11 from functional_groups ...

Еще в разделе: (Показать все результаты (>40319) - kodomo.fbb.msu.ru/ )

• allpy: 59320c160dae
• allpy: 325d165af197 allpy/markup.py
• allpy: 757f2a1f8732

... After the alignments are produced, T-aligner classifies all editing events (U insertion or U deletion) and clusters the reads into three groups: (i) those matching the reference sequence, (ii) those matching the putative main `editing pathway' (i.e., the user-defined final edited product) and (iii) all other reads containing alternative editing events. ... Reads in violation of any of these conditions are placed in the `alternative editing' group. ...

Еще в разделе: (Показать все результаты (>334) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/244.pdf

Электронная библиотека Попечительского совета . ... Cogswell J., Diggins C., Stephens R. - C++ Cookbook . ... Название: C++ Cookbook . Авторы: Cogswell J., Diggins C., Stephens R. Аннотация: . ... The C++ Cookbook will make your path to mastery much shorter. ... The algorithms provided in C++ Cookbook will jump-start your development by giving you some basic building blocks that you don't have to develop on your own. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12865) - lib.mexmat.ru/ )

• Mangano S. - XSLT Cookbook :: Электронная библиотека попечительского совета

... Changed: . A TWiki topic is a self-contained information unit rich in features: . ... instantly identify what the page is about . ... include Web links, images, anything else you can put on a Web page . ... browser-based controls for renaming, moving, and deleting pages: . ... move a page from one TWiki web to another . safely delete a topic to a special Trash web (invisible, but accessible to the TWiki administrators if needed) . ... On the page you want to change, click More > Rename/move . ...

Еще в разделе: (Показать все результаты (>42027) - dualopt1.cmm.msu.ru/ )

• TWikiTopics - TWiki - TWiki
• %TOPICTITLE% (8 vs. 9) - TWiki
• DeleteOrRenameATopic - TWiki - TWiki - (printable)

... Structure and properties of chimeric small heat shock proteins containing yellow fluorescent protein attached to their C-terminal ends. ... Recombinant chimeras of small heat shock proteins (sHsp) HspB1, HspB5, and HspB6 containing enhanced yellow fluorescent protein (EYFP) attached to their C-terminal ends were constructed and purified. Some properties of these chimeras were compared with the corresponding properties of the same chimeras containing EYFP attached to the N-terminal end of sHsp. ...

Еще в разделе: (Показать все результаты (>144) - biochem.bio.msu.ru/ )

• A protein whose binding to Na,K-ATPase is regulated by ouabain.
• Phosphorylation by cyclic AMP-dependent protein kinase inhibits chaperone-like
• Biochemistry Department of Moscow State University | Regulation of muscle

... 3.0.4 - 3.0.18 only, PHP 4 >= 4.0.0) imap_fetch_overview -- Read an overview of the information in the headers of the given message . array imap_fetch_overview ( int imap_stream, string sequence [, int flags]) . ... mbox = imap_open("{your.imap.host:143}","username","password") or die("can't connect: ".imap_last_error()); $overview = imap_fetch_overview($mbox,"2,4:6",0); if(is_array($overview)) { reset($overview); while( list($key,$val) = each($overview)) { print $val->msgno . ... val->subject . ...

Еще в разделе: (Показать все результаты (>804) - oit.cmc.msu.ru/ )

• imap_mail_copy
• imap_clearflag_full
• swat (8)

Chapter€а5.€а Getting images into GIMP . ... Image types . ... Working with Images . ... There are three possible modes: RGB, grayscale, and indexed. ... Because every humanly distinguishable color can be represented as a combination of red, green, and blue, RGB images are full-color. ... Essentially the difference between a grayscale image and an RGB image is the number of тАЬ color channels тАЭ: a grayscale image has one; an RGB image has three. ... A color image in RGB mode with an Alpha channel. ...

Еще в разделе: (Показать все результаты (>462) - uneex.lorien.cs.msu.su/ )

• mod_dav - Apache HTTP Server

... Anatomy of a Topic . ... Topic Names . ... Figure: depiction of WebHome , ReferenceManual , ManagingTopics , ManagingWebs , MainFeatures topics contained in the System web Topics are the basic building block of a Foswiki site. ... The TopicsAndWebs topic you're reading now is contained in the System web (its complete, fully qualified name is System.TopicsAndWebs ). ... topics with a WikiWord name are automatically linked (as opposed to [[forced bracketed links]] - see WikiSyntax to learn more) . ...

Еще в разделе: (Показать все результаты (>41135) - wiki.cmc.msu.ru/ )

• FAQDeleteOrRenameATopic < System < Foswiki

1975SvAL.. ... Total number of objects found: 1 . Currently displayed are the first identifier in SIMBAD and the object type. By clicking on the [Dic CAT] anchor, you get the informations from the nomenclature dictionnary for the corresponding catalogue. By clicking on the identifier itself , you get the basic data and all the identifiers from SIMBAD. ... SBC 741 .. ... Dic SBC] . Return to object query page . E-mail to: question@simbad.u-strasbg.fr ...

Еще в разделе: (Показать все результаты (>344) - xray.sai.msu.ru/ )

• E-P transitions for different orbits
• Number of accreting X-ray binaries of selected types
• Initial parameters of compact stars

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. ... Filter for VirtualDub MSU Deblocking (68 KB, ZIP) . ...

Еще в разделе: (Показать все результаты (>235) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Graphics and Media Lab
• Video Matting Benchmark | Graphics and Media Lab Equation Equation Equation
• Video Matting Benchmark | Лаборатория компьютерной графики и мультимедиа

... Class . ... public class Schema . ... This is a set of ProtoVariable, the DimensionSet which is the union of the Dimensions used, and any global Attributes. ... contains (java.lang.String name) . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... a new Array containing the elements of this set. public ProtoVariable get (java.lang.String name) . ... If a different ProtoVariable with the same name, was in the set, it is returned, otherwise null is...

Еще в разделе: (Показать все результаты (>76) - angel.cs.msu.su/ )

• : Interface AttributeSet
• API Help
• : API Help

... List of solitary restriction endonucleases in complete prokaryotic genomes . List of groups of orthologous R-M systems. List of all analyzed genomes. Contains those orthologous groups that include at least one separated R-M system . R-M orthologous group ID . REs alignments . MTases alignment . Group 1 . ...

Еще в разделе: (Показать все результаты (>11965) - mouse.belozersky.msu.ru/ )

• PLANdbAffy: probe-level annotation database for Affymetrix expression
• Geometrical core
• PDB entries containing domains of the family "Ribbon-helix-helix protein, copG

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>233) - www.genebee.msu.ru/ )

• Screening protein sequence against PROSITE databank
• Fasta3 help
• GeneBee BLAST 2.2.22+ Services Help

Velarisation of bilabial consonants in Russian Galina Kedrova, Leonid Zaharov, Nikolay Anisimov Moscow State Lomonosov University Abstract The research in question is aimed at the experimental MRI-investigation of articulatory gestures corresponding to Russian bilabial non-palatalized phonemes [b] and [m]. ... Experimental data present a considerable grade of image matching for both labial consonants, either nasal or non-nasal, in the [a]_[a] frameset (except soft palate configuration in nasals). ...

Еще в разделе: (Показать все результаты (>263) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/kimmelman.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kazenin.pdf

A collection class is a class that can contain a number of items in a certain data structure and perform operations on the contained items; insert, remove, find etc. ... QList ; a doubly linked list structure. ... An iterator is a class for safely traversing the items in a collection: . ... Qt has an array template class, QArray , which stores the items directly in the array. ... We discuss QList here, but the same applies for all collection classes and all collection class iterators. ... Classes: . ...

Еще в разделе: (Показать все результаты (>601) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QCloseEvent Class
• Qt Shared Classes
• Qt Tutorial - Chapter 10

... Data . ... Solar energetic particles . ... Nucleon . ... Particle spectra at LEO . ... Overview ] [ Documentation ] [ SEP Events ] [ SEP Model ] . ... 1.2 High-energy heavy ions (Z = 6, 7, 8, 10, 12, 14, 16, and 26) by ACE spacecraft (SIS instrument) data are selected from: . ... The SEP events were selected by GOES-8 4th channel (15-40 MeV) data (see Fig.1). ... E тАУ ionтАЩs kinetic energy in MeV/nucl; Moc2 =938 MeV тАУ nucleon rest energy; †Я=v/c тАУ particleтАЩs relative velocity. ...

Еще в разделе: (Показать все результаты (>21) - smdc.sinp.msu.ru/ )

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>461) - www.parallel.ru/ )

• Deleting a File | PARALLEL.RU - Информационно-аналитический центр по
• The Info Object | PARALLEL.RU - Информационно-аналитический центр по
• Writing wrapper definitions | PARALLEL.RU - Информационно-аналитический центр