... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 ...

Еще в разделе: (Показать все результаты (>89) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!
• cheap longcham | С Днем Победы!

... Commision on Soil Genesis, IUSS . ... Institute of Geography, Russian Academy of Sciences, Moscow . Institute of Ecological Problems of the North, Ural Branch of RAS, Arkhangelsk . ... Dokuchaev Soil Science Institute, Moscow . ... Prof. Dr. G.V.Dobrovolsky (Russia, Dokuchaev SSS President) . ... Prof. Dr. F.N.Yudakhin (Russia, Arkhangelsk Scientific Centre President) . ... Prof. Dr. Yu.G.Kutinov (Russia, Arkhangelsk, Director, Inst. ... Conference Secretariat . ... IV CONFERENCE ON CRYOPEDOLOGY . ...

Еще в разделе: (Показать все результаты (>499) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Projects
• The Period 1995 - 1999 of the Paleopedology Commission
• A LITTLE COMMENT to the Commentary about Soils, Paleosols and Geosols by Vance

... Make file etc. ... Model File 1 6 What is GRACE? ... Phys.Rev.D75, 113002('07) 15 GRACE for SUSY : Gauge Fixing Non-linear Gauge Fixing : S-leptons GF-S = 16 GRACE for SUSY : Renomarization Electro-weak corrections On-Mass-Shell scheme mass shifts for h0, H±, 0 2,3,4 only Sfermion sector 17 GRACE for SUSY : Renomarization QCD corrections 18 GRACE for SUSY : System Check Non-linear Gauge Check (One Phase Point) Ex. for One-Loop ~~ ~ ~~ ~ ~, , , , , , ) NLG Parameters : ( h H h H...

Еще в разделе: (Показать все результаты (>165) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf
• http://qfthep.sinp.msu.ru/talks2011/nekrasov.pdf
• http://qfthep.sinp.msu.ru/talks2015/Chesnokov_QFTHEP%202015.pdf

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>8) - iconolat13.phys.msu.ru/ )

• Invited speakers

Published on Department of the Automation for Scientific Research CMC MSU ( http://ani.cs.msu.su ) . ... Source URL: http://ani.cs.msu.su/en/node . ... 8] http://ani.cmc.msu.ru/files/Расписание лекций консультаций 2015 (2).xls . ... 12] http://ani.cmc.msu.ru/files/Защ.дипл.работ 2015 (бПМиИ).doc . 13] http://ani.cmc.msu.ru/files/Защ.дипл.работ 2015 (спец.).doc . 14] http://ani.cmc.msu.ru/files/Гос.экз. 2015 (бПМиИ).doc . 15] http://ani.cmc.msu.ru/files/Гос.экз. 2015 (спец.).doc . ...

Еще в разделе: (Показать все результаты (>6) - ani.cs.msu.su/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU
• Courses
• Alexander Pozdneev at the SIAG/LA-SIMUMAT International Summer School on

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>317) - mouse.belozersky.msu.ru/ )

• NPG-explorer
• Example of alignment
• Alignment example

Nuclear Instruments and Methods in Physics Research B 206 (2003) 830­837 www.elsevier.com/locate/nimb Gas cluster ion beam applications and equipment Allen Kirkpatrick * Epion Corporation, 37 Manning Road, Billerica, MA 01821, USA Abstract Interactions of gas cluster ions with solid surfaces, and prospective applications for those interactions, have been research topics of interest for several years. ... Cluster ion surface interactions Fig. 3 shows a simple representation of cluster impact. ... Fig. ...

Еще в разделе: (Показать все результаты (>98) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/Nimb245_06_28Balashova.pdf
• Библиотеки

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia e­mail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the so­called V­ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY Y­MP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>9) - asa.guru.ru/ )

• Alexander Antonov's Resume

email: valery_bondarev@mail.ru) , , , - , , environmental problems, environmental sociology, human ecology, time-spatial structure of social phenomenon, urbanization, urban sociology . ... Time-spatial structure of social practices which arise because of given interrelations are determined. The utmost multiplicity of resolving of environmental problems is shown (by the example of complex social interrelations on urbanized areas). ...

Еще в разделе: (Показать все результаты (>76) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/2/06.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/2/07.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/3/20.pdf

... For impatient users: You can download RusTeX in three different ways (Full installation; Selective download; Diskette-ready minimal installation) --- so at least read explanations about these methods before you download something. Please, use "Save link as" (right mouse button) for downloading files, otherwise .arj files and other binary files will be corrupted. ... TeX files are compact and readable in any text viewer: just text and commands for formatting and commands for equations drawing. ...

Еще в разделе: (Показать все результаты (>6) - tex.bog.msu.ru/ )

• http://tex.bog.msu.ru/texdisk.html

VIEWS Paul Murdin M T Wright Data, information and science I was one of almost half the IAU General Assembly that voted against the IAU resolution initiated by Elizabeth Griffin in Manchester in August 2000. ... The IUE archive, for example, delivers ultraviolet spectra into the hands of the community at the same rate that the satellite itself used to do, and papers frequently appear that are based on the archive. Other space missions like ISO and XMM have and are completing similar archives. ...

Еще в разделе: (Показать все результаты (>101) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/fomenko/fomenko2.pdf
• http://hbar.phys.msu.ru/gorm/fomenko/fomenko5.pdf
• newtrev1.htm

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• INTAS 95-525 Project Main Page

... 8 OpenFlow , , , , , , NAT, ARP, DNS, DHCP, BGP , , web · ­ · events per second · >10M · "" ­ · us · ­ 24/7 · ­ : ­ (2013) · · · · · · · · · NOX-Classic NOX Beacon Floodlight SNAC Ryu POX Maestro Trema · · · · · · · · · Helios FlowER MUL McNettle NodeFlow Onix SOX Kandoo Jaxon · Cisco ONE controller · Nicira NVP Controller · Big Network Controller · IBM Programmable Network Controller · HP SDN Controller · NEC Programmable Flow 11 · ­ ­ · ­ · ­ · ­ OpenFlow 12 5/30/2013 13 (2013) · 7 000 000 . ...

Еще в разделе: (Показать все результаты (>5) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

... Furman and A.V.Tikhonravov, "Basics of optics of multilayer systems" , Editions Frontiers, Gif-sur Yvette, 1992, 242 p. A.V. Tikhonravov, M.K. Trubetskov, I.V. Zuev and P.G. Verly, "Efficient Refinement of Inhomogeneous Optical Coatings", in "Optical Interference Coatings", OSA Technical Digest Series, vol. ... A.V. Tikhonravov, M.V. Klibanov, I.V. Zuev, "Numerical study of the phaseless inverse scattering problem in thin film optics", Inverse problems, 1995, Vol. 11, pp. ... Основные публикации . ...

Еще в разделе: (Показать все результаты (>30) - www.srcc.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>19) - observ.pereplet.ru/ )

• Обсерватория

... Дисциплины . ... On-line консультант . ... Главная Дисциплины Основы IT - менеджмента . Лектор и автор курса Козлов Д.Д. В курсе рассматриваются вопросы выстраивания экономически эффективной ИТ-инфраструктуры предприятия на основе сервисно-ориентированной модели ITSM. В рамках курса изучается библиотека IT Infrastructure Library и рассматриваются процессы управления информационно-коммуникационной инфраструктурой, предоставления и поддержки услуг. ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>8) - erp.cmc.msu.ru/ )

... COMPUTATIONAL . ... Scientific description and computerization of archives . Researchers of the Rare Books and Manuscripts Department of the Scientific Library of Moscow State University, the Orthodox Svyato - Tikhonovsky University and the Laboratory for Computational Lexicography are working on the scientific description of I. A. Ilyin’s personal archives. ... The conception of scientific description and computerization of archives was developed within the framework of this project. ...

Еще в разделе: (Показать все результаты (>30) - lcl.srcc.msu.ru/ )

Aleksanteri Institute Visiting Scholars Programme Aleksanteri Visiting Fellowships 2013 ­2014 THE FELLOWSHIP Is intended for scholars who hold a PhD degree in a field relevant to the Aleksanteri Institute 's research agenda and whose place of residence i s outside of Finland Is for a period of two to three months between August 2013 and June 2014 Involves a research stay at the Aleksanteri ... An electronic application form 2. ... The applications are evaluated by three experts. ...

Еще в разделе: (Показать все результаты (>145) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/Aleksanteri_Visiting_Fellowships_2011-2012.pdf
• Вестник Московского университета | Высшая школа бизнеса МГУ им. Ломоносова
• Выпуск 2/2010 | Высшая школа бизнеса МГУ им. Ломоносова

... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>36) - nanofluidics.phys.msu.ru/ )

• Research