... Program . ...

Еще в разделе: (Показать все результаты (>22) - pont2008.cmc.msu.ru/ )

• Optimal Control and Differential Games. Poster session Международная

... Agriculture University, 6700 EV Wageningen, The Netherlands ( author for correspondence) Accepted 22 May 1998 Key words: mathematical model , methanogenesis, partial derivatives, sulphate reduction, UASB reactor Abstract The existing mathematical models of sulphate fed anaerobic reactors are reviewed ... 1994; Vavilin et al. ... Existing mathematical models of sulphate fed reactors The first model of sulphate fed anaerobic reactors was developed by Gupta et al. (1994) for a chemostat. ...

Еще в разделе: (Показать все результаты (>115) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ryabov/pdf/O_97.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/UASB2006.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/abb_2003_3347.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... Main page Catalogue Login . Your account | ... eMail Address: . Password: . Password forgotten? ... New Customer . Through your registration at our shop you are able to shop faster, know at any time the status of your orders and have always a current survey of your previous orders. I am a customer . ... Visitor orderer . I would like to order only as visitor . Through your order as visitor at our shop your dates are not stored and you do not have an account. ...

Еще в разделе: (Показать все результаты (>22) - www.bukivedi.ru/ )

... Development of a candidate secondary reference procedure (immunoassay based measurement procedure of higher metrological order) for cardiac troponin I: I. Antibody characterization and preliminary validation. ... In this study, the first steps in the development of a secondary reference measurement procedure (RMP) 'higher metrological order measurement procedure' to support the cardiac troponin I (cTnI) standardization initiative is described. ...

Еще в разделе: (Показать все результаты (>54) - biochem.bio.msu.ru/ )

Femtosecond Time-Resolved Transverse Kerr Effect Measurements in Magnetoplasmonic Crystals A. Yu. ... Application of external magnetic field to a magnetic medium causes alteration of reflected light amplitude that is so-called magneto-optical Kerr effect. ... For example, excitation of surface plasmon polaritons (SPP) in a magnetized sample by femtosecond laser pulses can lead to time moduation of magneto-optical transversal Kerr effect (TKE) intensity that differs from its steady-state value. ...

Еще в разделе: (Показать все результаты (>62) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/ol40_1571_2015.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jap113_17a946_2013.pdf
• http://nanolab.phys.msu.ru/sites/default/files/ol33_699_2008.pdf

Кафедра высокопроизводительных вычислений МГУ . Главная . ... Главной задачей кафедры является организация и осуществление на высоком уровне учебно-воспитательной работы по подготовке специалистов высокой профессиональной квалификации по высокопроизводительным вычислениям на многопроцессорных ЭВМ из числа студентов 2-5 курсов механико-математического факультета , физического факультета , факультета вычислительной математики и кибернетики, химического факультета и других факультетов ...

168. http://ccoe.msu.ru/sites/default/files/presentations/Moscow-Keynote-Hwu-10-22-2012.pdf

169. http://genphys.phys.msu.su/rus/sci/photonics/PDF/6.pdf

170. Faculty Staff

---

Астронет | Научная сеть | ГАИШ МГУ | Поиск по МГУ | О проекте | Авторам

Комментарии, вопросы? Пишите: info@astronet.ru или сюда