. This page uses frames, but your browser doesn't support them.

Еще в разделе: (Показать все результаты (>731) - num-anal.srcc.msu.ru/ )

• Артикли
• Запятые
• Наречные обороты

... In 1997, the work of Jens Skou devoted to discovery and the study of Na,K-ATPase was culminated in the Nobel Prize. ... Our group works in the collaboration with the University of Montrel, Canada (professor S.N. Orlov), and with the Engelgardt Institute of Molecular Biology, Moscow, Russia (Laboratory of conformational stability of proteins and physical methods of analysis, under the guidance of academician A.A. Makarov). ... S-glutathionylation of the Na,K-ATPase catalytic ? ... Biochemistry (Mosc)...

Еще в разделе: (Показать все результаты (>39) - biochem.bio.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . browse.css . 2008-10-28 19:46 . 805 . chime.css . 2008-06-05 17:58 . 408 . hfpage.css . 2008-06-05 17:58 . 1.1K . intermediate.css . 2008-06-05 17:58 . 92 . jmol.css . 2008-06-05 17:58 . 229 . scop.css . 2009-07-19 17:32 . 260 . style.css . 2009-07-19 16:23 . 3.8K . Apache/2.4.10 (Debian) Server at monkey.belozersky.msu.su Port 80

Еще в разделе: (Показать все результаты (>187) - monkey.belozersky.msu.su/ )

... A particularly interesting family of examples are given by the weighted projective spaces CP n (), which depend upon a vector of positive integral weights (0 ,...,n ) for their definition. ... Nevertheless, the ultimate goal is to outline recent work with Tony Bahri and Matthias Franz, in which we compute the equivariant integral cohomology ring HT (CP n ()), with respect to the action of the standard compact n-torus T < (C \ 0)n . ...

Еще в разделе: (Показать все результаты (>13) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Zakalyukin.pdf

О факультете . ... Психологи МГУ . ... English . ... История факультета . Награды факультета . ... Совет по психологии УМО университетов РФ . ... Правила приема на факультет психологии МГУ . ... Клуб выпускников факультета психологии МГУ . ... About the Yearbook ћ Volumesв ћ Editorial Board ћ Instructions for Authors ћ Distribution ћ Contacts . ... Order: Author's Initials followed by Family name, Place of occupation, City, Country (e.g. A.A. Familyname, Lomonosov MSU, Moscow, Russia) . ...

Еще в разделе: (Показать все результаты (>135) - www.psy.msu.ru/ )

• The requirements participate in the competition between the papers of students,

... In vitro, the protein S7 of Thermus thermophilus is able to form complexes with both the minimal 16S rRNA fragment and the intercistronic region of the str operon mRNA from E.coli (Kd = 1.4x10-7 M and 1.1x10-7 M respectively). ... The filter binding assay. ... The most striking result of our study is that thermophilic protein S7 binds strongly to the E.coli S12-S7 intercistronic region of str mRNA in vitro, inspite of the lack of the functionally analogous thermophilic extended region. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

Faculty of Global Studies, Lomonosov Moscow State Uiversity Information Sheet 2014- 2015 GENERAL INFORMATION University Website Faculty Website for Exchange Students Academic Guide for Exchange Students Mailing Address of the Faculty (for courier delivery as well) Contact Information of the international department of the Faculty http://www.msu.ru/ http://fgp.msu.ru/ http://fgp.msu.ru/ru/ ... The faculty provides exchange students with the dormitory. ...

Еще в разделе: (Показать все результаты (>99) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2013/12/Luce_Moscow_2013_small.pdf
• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf

... International Studies . ... Admission for International Students . ... For Students . ... General Russian Courses . ... The Faculty of Foreign Languages and Area Studies at Moscow State University offers courses of General Russian to learners of all levels from Absolute Beginners through to Advanced. ... Beginners I - This course aims to help the student to acquire some knowledge of basic Russian, so that s/he can communicate with Russians, using basic vocabulary and grammar to express him/herself. ...

Еще в разделе: (Показать все результаты (>115) - ffl.msu.ru/ )

• About Us
• Contact Us
• Research

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Subject to the MOIP Charter both natural and legal persons may become the members of the Society upon paying admission fees and acknowledging the Charter and program documents. ... Persons may be elected as the Society?s full and corresponding members on a show of hands at the Society?s Council (Presidium) meeting if nominated by a section and recommended by at least two full Society?s members. ... The Society?s full members have the following rights: . ... 2015 Moscow Society of Naturalists . ...

Еще в разделе: (Показать все результаты (>2) - www.moip.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

Marketing Plan Outline Canada Business Service Centres - CBSCs Last Verified: 2004-11-08 Document No. 4014 Summary A marketing plan is designed to direct company activities towards the satisfaction of customer needs; determine what the customer wants, develop a product/service to meet those needs, get the product/service to the end user and communicate with the customer - at a profit! ... levels, sales volumes? ... What is the consumer acceptance price range for this type of product/service? ...

Еще в разделе: (Показать все результаты (>20) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/settingupapaysystem.doc
• http://www.innovation.msu.ru/english/venturecapital.doc
• http://www.innovation.msu.ru/english/pointstoconsider.doc

Warning: scandir(./db): failed to open dir: No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 Warning: scandir(): (errno 2): No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 . This database contains Solar Energetic Particles(SEP) fluences, measured from august 1997 till 2006 with the instruments on the satellites GOES and ACE. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

• SWX - Главная
• SWX - Анализ
• SWX - О проекте

... To save time, I will only provide ephemerides in 2000 coordinates. ... Note: most the orbital elements used to create these ephemerides were obtained from the International Astronomical Union Circulars (IAUCs), Minor Planet Circulars (MPCs) or the ICQ Comet Handbook. ... The following 1-day ephemeris (March 1, 1997 - October 1, 1997) is from Donald Yeomans of JPL and is based on Reference Orbit #55 (March 4, 1997). 2000 coordinates (March - September, 1997) [3/4/97] . ... Epoch: 1997 Feb. 1.0 . ...

Еще в разделе: (Показать все результаты (>22) - www.issp.ac.ru/ )

• Founding of the Olympiad
• Contents of /univer/astro
• Comet Observation Home Page (Chernogolovka)

... справочник учебные материалы ссылки программы . ... III Give English equivalents. 1. это не всегда так . ... 14.устанавливать истинный порядок элементов . ... 17.поиск недостающих элементов . 18.заключаться в (дать II и III формы) . ... Периодическая таблица Менделеева была окончательно заполнена после того, как недостающие элементы были открыты. новости студенты преподаватели лаборатории интернет-олимпиада по химии . справочник учебные материалы ссылки программы дни химика . ...

Еще в разделе: (Показать все результаты (>7) - www.students.chemport.ru/ )

• тест ?4 по английскому языку
• тест ?2 по английскому языку
• Список слов, необходимых для сдачи экзамена по английскому

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>16) - optics.sinp.msu.ru/ )

• Fizfakovskie pesni
• Speleofolklor
• polist99