... The students of the Faculty of Geography study territorial distribution and spatial development patterns of various natural phenomena as well as social and economic objects. ... The academic program includes courses with lectures, seminars, laboratory and field training in natural sciences and humanities which form 4 blocks: . ... In addition to the field stations of the Faculty, the students have an opportunity to have their field training in scientific institutions and different companies. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

• Postgraduate study
• Selenga-Baikal research

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>179) - www.genebee.msu.ru/ )

• MUSCLE User Guide
• GeneBee BLAST 2.2.8 Services Help
• GeneBee BLAST 2.2.22+ Services Help

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>20) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Blocks finder
• NPG-explorer

... Faculty of Physics . ... Research Centers . ... Search Faculties Staff . Education . ... Any division Budget Depatment Center of Computer Physics (CCP) Center of Education Quality Control Center of Hydrophysical Studies Center of Information Systems and Technologies (CIST) Chair of Acoustics Chair of Astrophysics and Stellar Astronomy Chair of Atomic Physics , Plasma Physics , and Microelectronics Chair of Biophysics Chair of Celestial Mechanics, Astrometry, and Gravimetry ...

Еще в разделе: (Показать все результаты (>2) - phys.msu.su/ )

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>155) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf
• http://qfthep.sinp.msu.ru/talks/pr_Gamzova.pdf
• http://qfthep.sinp.msu.ru/proceedings2015/Plenary_Arbuzov.pdf

... A Primer from the Reform of Personal Income Taxation in Russia Introduction. ... However, to use the welfare function one needs to aggregate individual preferences that can also be unknown. ... The derivations lead to the conclusion that the optimal marginal income tax rate is increasing as the elasticity of labor supply increases. ... In this paper we obtain the characteristics of the labor supply for different population groups to get the elasticities of labor supply with respect to a post tax...

Еще в разделе: (Показать все результаты (>10) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./bonham_surin.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./vorontchuk.pdf

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>106) - imaging.cmc.msu.ru/ )

M.H. Shulman, 2006 Michael H. Shulman TIME AND QUANTUM BEHAVIOR The paper presents an abstract of my talk at the Russian Interdisciplinary Temporology Seminar (23 of May, 2006th ). ... The following statements are argued: · The World time-space structure including its relativistic features are due to the quantum object features. Thanks to de Broglie we understood that each quantum object corresponds with some wave. ... A mathematic "exotics" of the quantum physics consists in two components. ...

Еще в разделе: (Показать все результаты (>396) - chronos.msu.ru/ )

• Wesely
• GEOMETRY, TIME AND THE LAW OF CONTINUITY
• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS

Born: August 29, 1978, Moscow, USSR (current Russia). ... 2000-present . Ph.D. student, Department of petrology, Moscow State University . 1995-2000 . ... June, 2000 . ... Researcher in RFBR project "Experimental researching melt inclusions in minerals" with Dr. Aleksey Kotelnikov, Dr. Eugeniy Gramenitskiy and Dr. Pavel Pletchov of Moscow State University . ... Trusov S.V., Pletchov P.Yu. ... Trusov S.V. (2000) "The influence of boundary layer effects on the melt inclusions compositions." ...

Еще в разделе: (Показать все результаты (>376) - geo.web.ru/ )

• Second International Digital Earth Symposium - Все о Геологии (geo.web.ru)
• Представление специалиста
• Eldfell, Heimaey, Iceland

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... как в матлабе записать квадратную матрицу в файл тхт? . ... Re: как в матлабе записать квадратную матрицу в файл тхт? [ re: Demandeur ] . ... attribute and its value. ...

Еще в разделе: (Показать все результаты (>5368) - www.snto-msu.net/ )

• Выделение прямоугольной области в редакторе - Public forum of MSU united
• как поставить MSDN - Public forum of MSU united student networks
• Есть в сети у кого C&C Generals и Zero Hour - Public forum of MSU united

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/pmt_param_eng.pdf

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Other prospects of the change-point based analysis

... If you have already registered, please fill in you login and password in the form below main menu (leftmost column). ... If something goes wrong (for example, you've been registered by site andministrator and don't have password at all or you just forgot it), please contact site administration by E-mail dubna2007@biophys.msu.ru . ... If you are warned that you've already registered please contact site administration by E-mail dubna2007@biophys.msu.ru to get access to your Personal Office . ...

Еще в разделе: (Показать все результаты (>38) - www.msm.biophys.msu.ru/ )

Curriculum Vitae Konstantin Katamadze Department of Quantum Electronics, Faculty of Physics, M. V. Lomonosov Moscow State University, Leninskie gory, 1, str.2, Moscow 119992, GSP-2, Russia Tel: +7 495 939 43 72 Email: Katamadze@inbox.ru EDUCATION 1993 - 2004: Moscow State 57-th School of General Education; 2004 - 2010: M.V.Lomonosov Moscow State University (MSU). ... Final degree: Master of Physics; 2007 - present time: M.V.Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>76) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/papers/2009-jetp(e)-108-33.pdf
• http://qi.phys.msu.ru/kulik/Papers/PRA42303.pdf
• http://qi.phys.msu.ru/straups/CV.pdf

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>19) - site2010.sai.msu.ru/ )

... What is the author's opinion on the problem? ... Organize the following parameters into 3 groups: content, organization, presentation (performance) · Body-language and eye contact · Fluency · Proper intonation and pronunciation · Relevant information and examples provided · Conclusion · Key concepts explained\defined · A range of complex grammatical structures and academic vocabulary · Key points emphasized · Introduction · Various linking devices, the transition from one point to the ...

Еще в разделе: (Показать все результаты (>22) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/business_english2.pdf
• http://www.eng.math.msu.su/download/section_1.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

trendence Graduate Barometer Europe 2011 About the survey ­ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )

... M. V. Lomonosov Moscow State University . ... M.V.Lomonosov Moscow State University, Moscow, Russian Federation . ... PhD at the Department of Electrochemistry, M.V.Lomonosov Moscow State University . ... S.Trasatti, O.A.Petrii, "Real surface area measurements in electrochemistry" J.Electroanal. ... O.A.Petrii, S.Ya. ... O.A.Petrii, G.A.Tsirlina, T.V.Rakova, S.Yu.Vassiliev, "Anomalous features of thallium oxide electrodeposited layers and room temperature HTSC electrosynthesis", J.Appl. ...

Еще в разделе: (Показать все результаты (>17) - www.elch.chem.msu.ru/ )

• Pron'kin Sergey Nikolayevich
• Galina A. Tsirlina

. WINAMP . playlist . 11 tracks in playlist, average track length: 44:56 . Playlist length: 8 hours 14 minutes 19 seconds . Playlist files: DJ Skinner-Purple rose . m-NuClEaR - gobble-mix. HH2!!s . Nuclearsound . prick . m-NuClEaR - remember stritz . set . threedays . tssf-05171999-m3-gabbergirl . tssf-19990222-gabbergirl . tssf-19990422-Ozone-3-Gabbe . tssf-19990531-m3-gabbergirl . tssf-19991001-switchcraft-vandenbroek-56k . tssf-19991004-mcubed-gabbergirl . tssf-1999-djspree-mixtapeAside .

Еще в разделе: (Показать все результаты (>10) - optics.sinp.msu.ru/ )

Head of sector, acting head of the Computational Geophysics Division of the M.V. Keldysh Institute for Applied Mathematics, RAS. ... Finished the Electrodynamics and Quantum Theory Department of Faculty of Physics, MSU in 1962. ... Ill-posed problems, stochastic processes, theory of approximation. Mechanics and physics of multi-phase media, phenomena in porous media, difference schemes for some classes of mathematical physics problems (filtration, elasticity theory). ...

Еще в разделе: (Показать все результаты (>3) - compmech.math.msu.su/ )