... Division of General Nuclear Physics MSU . ... INP MSU . ... Faculty of Physics MSU . ... The ANTARES project is the largest project on registration astrophysical neutrino by detection of cherenkov radiation from secondary particles, arising by neutrino interaction with substance of the Earth. ... Since June, 2009 the group of the Lomonosov Moscow State University takes part in the project. ... Our group consists of young researchers of MSU Skobeltsyn Nuclear Physics Institute and Faculty of Physics....

Еще в разделе: (Показать все результаты (>24) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>46) - www.inorg.chem.msu.ru/ )

• Ardashnikova E.I.
• Joint Semiconductors Surface Study group
• Inorganic Chemistry Division

MSU . ... In Doha, Qatar, decided the capital of the World Conference of the International Association of Science Parks and innovative development in 2016 (IASP 2016 World Conference). Based on the voting right of the prestigious international event went to the joint application of the Science Park of Moscow State University. ... 2-4 June 2014, Moscow hosted the Third International Summit of technology parks and business incubators "Technoparks as new drivers of national economic development." ...

Еще в разделе: (Показать все результаты (>30) - www.sciencepark.ru/ )

• MSU Science Park - Services
• MSU Science Park - About us
• MSU Science Park - Companies

... heat and mass transfer; . kinetic theory of gases; . ... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>7) - lab106.imec.msu.ru/ )

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 703 Then the system under study equation): 1 = = 2 3 = takes the following form (we deleted two multipliers from every (F (2 )+ F (3 ))1 (-1+2F (3 ) - 1 2 ), (F (3 )+ F (1 ))2 (-1+2F (1 ) - 2 2 ), (F (1 )+ F (2 ))3 (-1+2F (2 ) - 3 2 ). ... Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 709 function, the system takes the form (4.2). ...

Еще в разделе: (Показать все результаты (>124) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/283/149-gauss-principle-and-realization-of-constraints_en.pdf
• http://ics.org.ru/upload/iblock/ecf/PHDK32.pdf
• http://ics.org.ru/upload/iblock/702/176-the-dynamics-of-a-rigid-body-with-a-sharp-edge-in-contact-with-an-inclined-surface-in-the-presence-o_ru.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

: .. , . .. ( e-mail: alanov87@gmail.com) , , , , , , socio -cultural situation, Tradition, Innovation, modern Russian society, spirituality, valuables , , . . In the following article the range of issues associated with modern Russian society social and cultural situation is analyzed. The latter is considered the synthesis of tradition and innovation. The innovation is seen as the reproduction of traditions in the new environment and on the whole new level.

Еще в разделе: (Показать все результаты (>56) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/3/06.pdf

NUCLEAR ASTROPHYSICS Yu. ... ейСЦгъ кДлтакьыфЦвль ЗлЦгЦззйв 68 ї иВМЛУМКНВ,Л~ ы.щ., 1998 1965 "", , , , 3 . ... иЦзайзЬдЦЗау ы.щ. ьСЦкзДь ДлнкйоабадД 69 100 (1012 ), , . ... 100 1 1 . ... 1, , , 1 1010 . ... 40 (1,3 109 ) 87 232 40 Ar, Sr, Pb, Rb (4,8 1010 ) 87 Th (1,4 1010 ) U (4,5 109 ) 208 206 238 Pb]. ... 238U - 238, r- - 242, 246 250. 250 238U. 235U 238U, r- . ... s-, ( 1,64 1,0 ( 235 C 15 + N 1,0 (, ) U/ 238 U) "" CNO "" CNO 238 235 , 235U/ 238U = 0,29 U/ 238U = 0,65 235U/ 238U = 1,21 109 . ...

Еще в разделе: (Показать все результаты (>163) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/thgr/eng/ch5.pdf
• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter10_Cost-Time%20Schedule.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Konstantinova.pdf

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>15) - www.protein.bio.msu.ru/ )

... CUDA Center of Excellence | MSU . ... Lomonosov Moscow State University (MSU) was awarded an NVIDIA CUDA Center of Excellence (CCOE) in 2011 for being one of the first Russian universities to recognize the importance of emerging GPU technologies and first to embrace CUDA. ... Lomonosov Moscow State University (MSU) is renowned as one of the leading computer science centers excelling in application of computational resources to address most vital scientific problems. ...

Еще в разделе: (Показать все результаты (>4) - ccoe.msu.ru/ )

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>5) - www.bio.msu.ru/ )

... For full UV energy Euv (erg) radiated in TLE the corresponding number of photons of wavelength =300-400 nm (with average energy 3.5 eV) is: Nph=Euv/3.5в1.6 10-12 (1) We considered 2 options of the pinhole camera focal distance: 1. focal distance is short so that the circle of diameter 40 km is observed by one pixel and 2. focal distance is long so that the 40 km circle is observed in many camera pixels. ... Full energy released in UV in the atmosphere is determined by the pixel signal. ...

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>4) - oc.cs.msu.ru/ )

... The optimal control, which led oscillatory system to a certain energy level from any initial conditions at minimum time, is found. ... A set of points where the trajectory becomes an arc of a circle with the other center is called the switching line. ... For drawing switching line near the origin (see for example Figure 3) we note from the system (1) that time is proportional to the sum of the angles 214 this sums for optimal and quasi-optimal processes. ... The control function (14) is not optimal....

Еще в разделе: (Показать все результаты (>11) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf
• Anton O. Belyakov

The Nine Planets is best viewed on-line via a graphical WWW browser which displays the pictures in color and supports hypertext link traversal. ... To view the movies and hear the sounds, you'll need additional helper programs. ... I recommend that you use Netscape as your browser. Netscape can display gif and jpeg images directly without need of any additional helper apps. You do need additional helper apps for movies and sounds, however. ... Yahoo's Helper Applications .. ... Tech Help .. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

... Cleo batch system is purposed to control parallel tasks on computer clusters. It controls one or more task queues. tasks sceduling (all MPI implemetations are supported, most other parallel environments are supported too) . ... controllable user limits (max used cpus, task work time, etc.) . ... Any task in main will be queued to daughter queues if there aren't enough free own cpus (not shared with daughters). When daughter queues will get enough cpus for this task, it will be runned in main . ...

157. InCo literature in English

158. Online Consultation on Network and Partnerships in the area of Food Security |

159. Alumni Association

160. Форма 502