... 2 : 1 ­ , 2 ­ : 1 : 1) Define the subject of intercultural communication. What is the difference between intercultural and cross-cultural communication? ... 2) Define culture. ... Explain the role of metaphor in culture studies. ... 4) Enumerate the basic functions of culture. ... 13) Comment on the acute problems of intercultural communication in the modern Russian society 2 : 1) Was Edward Hall right to define communication as culture and culture as communication? ... 2) Define communication. ...

Еще в разделе: (Показать все результаты (>121) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/vestnik/4-2012-polubichenko.pdf
• http://www.ffl.msu.ru/research/vestnik/4-2011-Ilson.pdf
• http://www.ffl.msu.ru/students/courses/fl-teaching/3-bakhtiozina-istoriya-angliiskogo-yazika.pdf

Международный учебно-научный лазерный центр МГУ им. М.В. Ломоносова . ... Новости . О МЛЦ МГУ . Наука . ... Сотрудничество . ... Все новости . ... Конкурс-конференция на получение премии поддержки молодых ученых. Заявки до 25 октября 2015г. Семинар МЛЦ и кафедры . ... Главная Новости Наука . ... International Conference on Photo-Excited Processes and Applications. ... Другие новости категории: . ... Категория: Конференции . ... Категории: Наука , Сотрудничество . ... 2008 МЛЦ МГУ . ...

Еще в разделе: (Показать все результаты (>101) - ilc.phys.msu.ru/ )

• Laboratory of Nonlinear Spectroscopy of Ultrafast Processes in Condensed Matter
• Laboratory of ultrafast processes in biology
• Grant detail

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>133) - fgp.msu.ru/ )

• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf
• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf
• http://fgp.msu.ru/wp-content/uploads/2015/10/Congress_program_pdf.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Khimiya) .. ,~c~"C' Vol. ... Khimiya UDC 579.088;577.158.54 DEVELOPMENT OF A PHENOMENOLOGICAL MODEL OF THE KINETICS OF BACTERIAL ADSORPTION ON LOW-ENERGY SURFACES V. V. Fedorovich, S. V. Kalyuzhnyi, P. van der Meeren., and W. Verstraete.. ... Our work was dedicated to the establishment of a quantitative relation between the rate of adsorption of a certain class of microorganisms on polymeric materials and their adhesion to the latter. ... In this case the rate of adsorption does not depend on 6.Gh. ...

Еще в разделе: (Показать все результаты (>149) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ekbio/article/abb_2003_13.pdf
• Biostoning of Jeans
• B I O C A T A L Y S I S - 2007. Structure, functions, applications.

... Главная -> Фильмы -> Marked for Death . ... Фильмы . ... Marked for Death . ... Richard Delmonte . ... Joe Renteria . ... Matt Levin . Philip Tanzini . ... Prince Ital Joe . ... Matt O'Toole . ... Harry John Leamy . John Endeveri . ... Philip Chen . ... Richard Barr . ... После смерти напарника Джон Хатчер (Сигал), специальный агент отдела по борьбе с наркотиками, решает подать в отставку. Переехав к своей сестре в Чикаго, Хатчер намеревается вести тихое и размеренное существование. ...

Еще в разделе: (Показать все результаты (>5276) - kinfo.ru/ )

• Marked Woman - Фильмы - Kinfo.ru
• Marked Man - Фильмы - Kinfo.ru
• Process - Фильмы - Kinfo.ru

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• atmos 3.0 page

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>26) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/TTravouillon_TMT_site_testing_site2010.pdf
• http://site2010.sai.msu.ru/static/doc/OVoziakova_site2010.pdf.pdf
• http://site2010.sai.msu.ru/static/doc/GHerriot_site2010.ppt.pdf

University Satellites and . Space Science Education . ... Simulation of Carrier Phase GPS Observables and Feasible Attitude Determination Algorithms for Universitetskiy-Tatyana Satellite . ... Carrier phase observables of radio signals transmitted by navigation satellites, when obtained from multiple antennas, potentially could provide the most accurate and stable solution for attitude determination among other methods. ...

Еще в разделе: (Показать все результаты (>71) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University
• Space Scientific and Education project of Lomonosov Moscow State University -

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Basic server procedures are dedicated to homology (similarity) search of sequence and 3D structure of proteins. The homologies found could be used to build multiple alignments, predict protein and RNA secondary structure, and construct phylogenetic trees. ... KEY WORDS: mathematical and statistical biology, biological sequences databanks, macromolecular algorithms, sequence homology, sequence alignment, RNA secondary structure, protein secondary and tertiary structure, protein structure alignment. ...

Еще в разделе: (Показать все результаты (>221) - www.genebee.msu.ru/ )

• Biochemistry (Moscow), Vol
• BLAST Frequently Asked Questions (FAQ)
• services

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>7) - swx.sinp.msu.ru/ )

• SWX - Анализ
• SWX - О проекте

... CELL BIOPHYSICS Fluorescence Methods of the Photosystem II Activity Biomonitoring in Phytoplankton D. N. Matorin Biological Faculty, Moscow State University, Moscow, 119899 Russia Received May 12, 1999 Abstract--The photosystem II activity regulation by environmental factors was studied in microalgae. ... Key words: chlorophyll fluorescence, photosystem II, phytoplankton, biomonitoring INTRODUCTION The primary organic matter is formed in aquatic ecosystems as a result of photosynthetic activity. ...

Еще в разделе: (Показать все результаты (>39) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3340.pdf
• http://library.biophys.msu.ru/PDF/3344.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

e-mail: dk89@mail.ru) , , , , John Foran, revolution, postmodern, globalization, political cultures of opposition "" . The article presents John Foran's experience of bulding a theory of postmodern revolution based on overcoming the discourses of "the end" of modern revolution theorie's components. ... It contains the experience of postmodern and modern revolution's components compare in the baise of concept of political culture of opposition. ...

Еще в разделе: (Показать все результаты (>50) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2013/3/07.pdf

... Carbamide . ... Moscowљ? ... URALCHEM and Stamicarbon will develop a new technology for urea production . URALCHEM, a leading Russian producer of nitrogen fertilizers, signed a joint technology development agreement for the synthesis of urea with Stamicarbon, the world's top developer and licensor of urea processes. ... Laboratory of Chemical Thermodynamics љwasљestablished by Prof. Adam V. Rakovsky (corresponding member of USSR Academy of Sciences) first as a "halurgy laboratory" in 1930. ...

Еще в разделе: (Показать все результаты (>9) - td.chem.msu.ru/ )

... 2 1 2 (2008) 5­9 available at www.sciencedirect.com journal homepage: www.elsevier.com/locate/ecolmodel The impact of different density stresses on the dynamics of two competitive populations Anatoly T. Teriokhin , Elena V. Budilova Department of Biology, Moscow Lomonosov State University, Moscow 119992, Russia article Article history: info abstract We compare the asymptotic dynamics of two competitive populations described by a ... Second, only the density of youngs can be reduced. ...

Еще в разделе: (Показать все результаты (>36) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf

выделенного элемента /title /head body background = ../gif/brick.gif applet code=map_view.class name =red width= 250 height= 250 archive=map_view.zip codebase= ../ mayscript param name =layers_all value = example param name =layers_draw value = # example param name = example ...

Еще в разделе: (Показать все результаты (>24) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/layer/layer3text1.htm

BUSINESS ENGLISH LESSON PLAN FOR THE 2nd YEAR STUDENTS: II SEMESTER OF 2012-2013 ACADEMIC YEAR Compiled by: A.S. Matveeva Edited by: L.N. Vygonskaya This business English lesson plan has been designed for students of the Faculty of Mechanics and Mathematics who need to improve their business and social English skills rapidly, effectively and efficiently. ... The subject can be presented orally and students can be asked to contribute any relevant vocabulary they may already have. ... Home Task. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Midterm_test.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf
• http://www.eng.math.msu.su/download/dictionary.pdf

Mathematical modeling of biophysical processes in living cells and tissues . duration 6 months . ... 7(095) 939-26-12, Fax: +7(095)939-31-13, Email: romanov@yumr.phys.msu.ru . ... Interaction of femtosecond laser pulses with plasmas of modified targets . ... Theoretical investigations of polarization self-action and wave-interaction effects in nonlinear optics. ... Alexander V. Priezzhev, Associate Professor, Candidate of Sciences (physics and mathematics), Tel. ...

Еще в разделе: (Показать все результаты (>26) - foroff.phys.msu.ru/ )

• Postdoctoral training of foreign scientists at Physical Department
• Faculty's Tuition Structure