... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>21) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/page0.html

. December 999 . Mon . Tue . Wed . Thu . Fri . Sat . Sun . 1 . 2 . 3 . 4 . 5 . 6 . 7 . 8 . 9 . 10 . 11 . 12 . 13 . 14 . 15 . 16 . 17 . 18 . 19 . 20 . 21 . 22 . 23 . 24 . 25 . 26 . 27 . 28 . 29 . 30 . 31 .

Еще в разделе: (Показать все результаты (>4489) - fmp.msu.ru/ )

• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=12&year=10&catid=35&Itemid=1165
• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=12&year=100&catid=35&Itemid=1165
• http://fmp.msu.ru/index.php?option=com_k2&view=itemlist&task=calendar&month=12&year=1000&catid=35&Itemid=1165

Publications of O. Senko . ... Publications of Group . ... Chemical Enzymology Department, Chemical Faculty . The M.V. Lomonosov Moscow State University, Lenin's Hills, 1/11 Moscow 119992, Russia . ... 7 (495) 939-31-70, Fax: +7 (495) 939-31-70, +7 (495) 939-54-17 . ... Master's Degree, Moscow State Academy of Fine Chemical Technology, (2005) . ... Bachelor of economy, Moscow State Academy of Fine Chemical Technology, (2004) . ... Publications: . Number of Patents and Patent Proposals: 1 . ...

Еще в разделе: (Показать все результаты (>56) - www.enzyme.chem.msu.ru/ )

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>25) - www.sai.msu.ru/ )

• Digitization of Moscow Plate Archives

Школа танцев Грация-МГУ . ... Грация-МГУ::Форум Мультимедия Аудио . ... Оригиналы и ремейки . ... Oct 12 2006, 13:24 . Сообщение #1 . born to create drama . ... Первая песня оригинал, а вторая римейк? ... Подразумевается, что оригиналы всем знакомы и выкладывать их нет смысла. ... Подписка на тему Сообщить другу Версия для печати Подписка на этот форум . ...

Еще в разделе: (Показать все результаты (>7) - grace.msu.ru/ )

• Грация-МГУ::Форум > Оригиналы и ремейки

P h o t o A r c h i v e . Academic Lectures . ... Lecture by Member-Correspondent of the Russian Academy of Sciences, S.S. Averintsev, ?On Slavophilism and Europeanism?. ... Lecture by the Ambassador of Great Britain to Russia, Sir Andrew Wood, ?Russia - West?. ... Lecture by Academician of the Russian Academy of Sciences, B.V. Ananich, ?S.Yu. ... 18 March 1999. ... Lecture by Academician of the Russian Academy of Sciences, N.N. Bolkhovitinov (Institute of General History, RAS) "Russian America" . ...

Еще в разделе: (Показать все результаты (>3238) - hist.msu.ru/ )

• "Novaya i noveishaia istoria" Journal
• Программа сессии в Будапеште"

Fw: Лишайники г.Липецка - ответ М.А.Клепикову . Nataliya Lavrentyeva 15 декабря 2002 02:04:48 . ... To: "Maxim A. Klepikov" . ... Sent: Saturday, December 14, 2002 3:08 PM . ... Население Липецка полмиллиона человек. ... по лишайникам г.Тутаева. ... Это может быть вызвано более сильным загрязнением нашего города. ... центральной части города Тутаева, т.е. самой загрязненной. ... Областного Дворца культуры, парке Победы, парке Быханов сад, . ... http://www.fadr.msu.ru/ecocoop/klep.html . ...

Еще в разделе: (Показать все результаты (>21) - www.ecocoop.ru/ )

• http://www.ecocoop.ru/monitor/messages/560.html
• http://www.ecocoop.ru/monitor/messages/561.html
• http://www.ecocoop.ru/botany/archive2/messages/202.html

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>40) - www.msu.ru/ )

• Nikolay V. Syomin
• Web-сайты МГУ
• The scheme of an arrangement of MSU buildings on Leninskiye Gory

... MSU Codec Comparison aims to deliver high quality comparisons of video encoders to both industrial and scientific communities. ... The newest versions of MPEG-4 codecs comparison for their using by an ordinary user for home video compression. ... First Annual MPEG-4 AVC/ H.264 Video Codecs Comparison (January 2005) . ... Second Annual MPEG-4 AVC/H.264 Video Codecs Comparison(December 2005) . ... Third Annual MPEG-4 AVC/H.264 Video Codecs Comparison (December 2006) . ... Fifth H.264 codecs comparison...

Еще в разделе: (Показать все результаты (>78) - graphics.cs.msu.ru/ )

• Defense of Ph.D. thesis of Olga Barinova | Graphics and Media Lab
• MSU Video Codec Comparison | Лаборатория компьютерной графики и мультимедиа

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Brackets ( [[ ]] ) are used to link to a target (a local wiki page, an external URL, a file, etc). Braces ( {{ }} ) are used to embed (transclude/include/show) some target (often an image, but can be text). ... show attached image file image.png with alternative text alt text and aligned to position , where position can be one of top , middle , bottom , right or left (do not omit alt text) . ... show target image inline with alternative text saying alt text (recommended for accessibility) . ...

Еще в разделе: (Показать все результаты (>43) - uneex.mithril.cs.msu.su/ )

• HelpOnMacros/MonthCalendar - UNИX
• HelpOnImages - UNИX
• Index of /static/Sledes_LegalFOSS

PLAN of the main events of the Russian Rectors' Union (RRU) for 2008 |Statute events of the RRU | ... Session of RRU's Council |February | ... higher and post-graduate professional education"", in | ... Session of RRU's Council |June | ... and innovative activities of higher education institutions | ... Session of RRU's Council |September | ... Main activities of RRU's Council of Higher Education institutions' Presidents |1. ... Sessions of Science, Technology and Education Council under |Constantly | ...

Еще в разделе: (Показать все результаты (>22) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/333.doc

T he student body is the central group of the Faculty of Physics. ... The Faculty offers its students the widest choice of training programmes and majoring opportunities. ... C urrently there are about 40 general courses and over 650 specialized courses delivered covering a wide range of traditional and new areas of physics research. ... F rom the first year students can be trained under two programs physics or astronomy. ... T here is a specific education system in place at the Faculty of Physics. ...

Еще в разделе: (Показать все результаты (>15) - foroff.phys.msu.ru/ )

• Useful Information

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• RNA Kinetics: Result explanation
• SDPlight

organic papers Acta Crystallographica Section E Structure Reports Online ISSN 1600-5368 4,6-Dimethyl-5-nitro-1H-pyridin-2-one Victor B. Rybakov,* Alexander A. Bush, Eugene V. Babaev and Leonid A. Aslanov Department of Chemistry, Moscow State University, 119992 Moscow, Russian Federation Correspondence e-mail: rybakov@biocryst.phys.msu.su In the crystal structure of the title compound, C7H8N2O3, molecules form centrosymmetrical dimers via N HСССO hydrogen bonds. ... 2004). ... Acta Cryst. ... Cryst. ...

Еще в разделе: (Показать все результаты (>55) - www.chem.msu.ru/ )

• http://www.chem.msu.ru/eng/misc/babaev/papers/088e.pdf

... An array in PHP is actually an ordered map. ... The array type in PHP is very versatile, so here will be some examples to show you the full power of arrays . // this $a = array ( ' color ' = 'red' , 'taste' = 'sweet' , 'shape' = 'round' , 'name' = 'apple' , 4 // key will be 0 ); // is completely equivalent with $a[' color '] = 'red'; $a['taste'] = 'sweet'; $a['shape'] = 'round'; $a['name'] = 'apple'; $a[] = 4; // key will be 0 $b[] = 'a'; $b[] = 'b'; $b[] = 'c'; // will result in the ...

Еще в разделе: (Показать все результаты (>233) - oit.cmc.msu.ru/ )

• zip_entry_filesize
• printer_set_option
• Apache module mod_negotiation

... Head of the seminar: Prof. B.V. Somov, . ... The seminar considers the questions related to generation of magnetic fields in astrophysical plasmas, effect of the magnetic reconnection and particle acceleration in strong magnetic fields, the origin and propagation of cosmic rays, the flares and other non-stationary phenomena in the solar atmosphere and solar wind, Sun Earth connections and physical processes in the heliosphere. ... On the Topological Models and Topological Trigger of the Solar Flares...

Еще в разделе: (Показать все результаты (>3) - sun.sai.msu.ru/ )

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>2) - pk.math.msu.ru/ )

... Division of Applied Mathematics, . Faculty of Physics, MSU . ... Prof. A.G. Kushner: "Geometry of Jet Spaces and Applications in Mathematics and Physics" Seminar meeting of the devision of AM 14:00 aud. 4-46 . ... Morozov: "Automation Output Theorems about Conserving the Properties of Mathematical Models" Seminar meeting of the devision of AM 17:00 aud. ... Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016. ...

120. Данные - Группа дистанционного зондирования атмосферы