... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>379) - herba.msu.ru/ )

• Moscow State University Botanical Server
• Index of /shipunov/school/biol_154/textbook/pics
• Moscow State University, Geobotany dpt. - View Program

... Co-Chair , ICONO/LAT 2013 . Director, Institute of Laser Physics . ... Russia . ... Conference venue . Moscow, Russia . Program overview . Program topics . ... Advance program . ... Visa to entry Russia . ... ICONO/LAT conference is the leading event in the area of quantum electronics, laser physics, and their applications. ... You are greatly welcome to attend the ICONO/LAT 2013 conference in Moscow, Russia. ... International Laser Center, M.V.Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>22) - iconolat13.phys.msu.ru/ )

• Guidelines
• Program overview
• Program topics

Japan Student Services Organization (JASSO) Student Exchange Support Program Scholarship for Short-term Study in Japan [as of January 2016] This scholarship is available for qualified international students who are accepted by Japanese universities under student exchange agreements on a short-term basis. ... 7) Students who have a minimum GPA of 2.30 / 3.00 as calculated using JASSO's GPA calculation method shown below, based on a transcript from the previous academic year. ...

Еще в разделе: (Показать все результаты (>162) - phys.msu.ru/ )

• Семинар 'Modeling and Control of Physiological Process: Towards Systems
• "EURASIP Journal on Applied Signal Processing
• DIVISIONS AND CHAIRS

... A This result can be applied to a wide variety of data sets, including electricity bills1, street addresses, lengths of rivers, physical and mathematical constants, and processes described by power laws. ... Based on the plausible4 assumption that people who make up figures tend to distribute5 their digits fairly uniformly, a simple comparison of first-digit frequency distribution from the data with the expected distribution according to Benford's law had to show up any anomalous results. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section2.pdf

. Moscow State University . INTERNATIONAL CONFERENCE . H YDRODYNAMIC I NSTABILITY AND T URBULENCE . February 24 ? March 02 , 2008 . Moscow, Russia . Call For Papers Информационное письмо . Author instructions . Abstract example Paper example . Location (More information) . Conference Program Posters . E-mail : gertsens@imec.msu.ru . Institute of Mechanics, Lomonosov Moscow State University . Aerodynamical Installations . Moscow Sights & Attractions

Еще в разделе: (Показать все результаты (>22) - hit-conf.imec.msu.ru/ )

... X-COM: Distributed Computing Software . ... The idea of distributed computing, or metacomputing, is to combine available computational resources for different applications processing. ... For these applications we simultaneously used high-performance computational resources of Moscow State University and Russian Academy of Sciences, computing centers of Saint Petersburg, Novosibirsk, Chelyabinsk, Ufa, Tomsk, etc. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>49) - hpc.msu.ru/ )

• Supercomputing Education Project | Moscow University Supercomputing Center
• Nationwide Supercomputing Education Project | Moscow University Supercomputing
• HOPSA - the joint RF/EU project: HOlistic Performance System Analysis | Moscow

... Research objects and scientific purposes . Space scientific program includes development and launch of two supersmall spacecrafts "Universitetskiy" and "Kompas-2" intended for monitoring of radiation conditions near the Earth. ... All the studies conducted in the near-Earth space are characterised by strong radiation fields. ... The circular polar orbits, which cover all the near-Earth space, are the most favorable for comprehensive studies of the radiation conditions near the Earth. ...

Еще в разделе: (Показать все результаты (>73) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

... Gamma-activation analysis is being used to study these processes at SINP MSU. A software package for processing experimental data from HPGe detector has been developed. The program uses Monte-Carlo method to simulate main stages of the experiment and presents results on a graphical interface. (,n) , . ... 5-6 70 . ... HPGe). ... GEANT4 . GEANT4 HPGe , . ...

Еще в разделе: (Показать все результаты (>168) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/1998_10.pdf
• A.M.Baldin

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Как запустить экзэшник визуалка 2005 под винду . ... 01.09.2005 . ... Re: Как запустить экзэшник визуалка 2005 под винду [ re: CrUeL ] . ...

Еще в разделе: (Показать все результаты (>1441) - www.snto-msu.net/ )

• прога удаленного форматирования по дате - Public forum of MSU united student
• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU
• злое%;?"чий php.как в нем дебаггер поставить? - Public forum of MSU united

... 2 What is MATLAB ?? Basic Matrix Operations Script Files and M-files Some more Operations and Functions APPLICATIONS: Plotting functions .. ... Vectors are special forms of matrices and contain only one row OR one column. Scalars are matrices with only one row AND one column MATLAB Matrices 17 A matrix with only one row AND one column is a scalar. A scalar can be created in MATLAB as follows: » a_value=23 a_value = 23 MATLAB Matrices 18 A matrix with only one row is called a row vector. ...

Еще в разделе: (Показать все результаты (>21) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf
• http://imaging.cs.msu.su/~yurin/Doxyfile
• Imaging lab: people

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>44) - www.inorg.chem.msu.ru/ )

• Inorganic Chemistry Division

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>9) - oc.cs.msu.ru/ )

... Data . ... Solar energetic particles . ... Solar flare database (RU) . ... Select the storm date: . Select storm intensity threshold: . ... Developed in 2007. Copyright €й 2007 - 2016 Skobeltsyn Institute of Nuclear Physics Moscow State University Feedback ...

Еще в разделе: (Показать все результаты (>26) - smdc.sinp.msu.ru/ )

• APEV service - Space monitoring data center
• ShielDose2 model - Space monitoring data center
• IGRF10 model - Space monitoring data center

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>12) - optics.sinp.msu.ru/ )

• polist99
• zagedan

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>80) - textbook.sinp.msu.ru/ )

Some additional inquiry information . ... help information) . Here you can read some articles, describing details of calculting process. We hope, after having these articles read, you'll surely know, what and how does this program work. Alignment formats . ... WPGMA - method for sequence weighting and tree constructing . Alignment quality estimation: "The rule of fours" . Phylogenetic tree schemes . Criteria of branch quality . Evolution reconstruction: parsimony method . ...

Еще в разделе: (Показать все результаты (>309) - monkey.belozersky.msu.ru/ )

• SDP home page
• About this project
• SDPpred

... Human pro-B-type natriuretic peptide is processed in the circulation in a rat model. ... BACKGROUND: The appearance of B-type natriuretic peptide (BNP) in the blood is ultimately caused by proteolytic processing of its precursor, proBNP. ... RESULTS: ProBNP was effectively processed in the circulation into BNP (1-32) and various truncated BNP forms as confirmed by gel filtration and MS analysis. ... CONCLUSIONS: In rats, processing of human proBNP to active BNP occurs in the circulation. ...

Еще в разделе: (Показать все результаты (>41) - biochem.bio.msu.ru/ )

• Processing of pro-brain natriuretic peptide is suppressed by O-glycosylation in
• Processing of pro-B-type natriuretic peptide: furin and corin as candidate
• Biochemistry Department of Moscow State University | Education

... Industrial Application of Power Ultrasonics . ... Novel technical means such as laser, plasma, electromagnetic fields and fluxes of high-energy particles extend substantially the possibilities of active influence on physicochemical processes. Intense elastic vibrations of ultrasonic frequency range provide a means for an active control of the processes of heat and mass transfer in various substances, the structure of solids, and the processes of the interaction between contacting materials. ...

Еще в разделе: (Показать все результаты (>201) - acs366.phys.msu.su/ )

• Abstract
• Devices and Industrial Applications of Nonlinear Acoustics
• Schedule : Devices and Industrial Applications of Nonlinear Acoustics

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... Master . ... SAI MSU . Conference was supported by PLC "MO "OPTIKA" . ... Morning session . Chair Hugo Levato (ICATE, Argentina) . ... Vladimir Lipunov ( MSU , SAI ) . ... Evgeniy Gorbovskoy (MSU, SAI) & . А lexander Belinskiy (MSU, SAI) . ... Chair Claudio Mallamaci (OAFA, Argentina) . ... Using MASTER Net in the MSU educational process . ... Chair Victor Kornilov (MSU, SAI) . ... Nikolay Budnev (ISU ) . ... Excursion to the Moscow Kremlin . ... Joint MASTER and Russian Pereplet session. ...

Еще в разделе: (Показать все результаты (>11) - master.sai.msu.ru/ )