... Furman and A.V.Tikhonravov, "Basics of optics of multilayer systems" , Editions Frontiers, Gif-sur Yvette, 1992, 242 p. A.V. Tikhonravov, M.K. Trubetskov, I.V. Zuev and P.G. Verly, "Efficient Refinement of Inhomogeneous Optical Coatings", in "Optical Interference Coatings", OSA Technical Digest Series, vol. ... A.V. Tikhonravov, M.V. Klibanov, I.V. Zuev, "Numerical study of the phaseless inverse scattering problem in thin film optics", Inverse problems, 1995, Vol. 11, pp. ... Основные публикации . ...

Еще в разделе: (Показать все результаты (>4) - www.srcc.msu.ru/ )

... 220-221 ( ) 13 Exponentially growing localized solutions for linearized Navier { Stokes equations ( ) . Russian Journal of 6 . Mathematical Physics, 1, 3, 1993, . ... Proceedings of the 1c. First Russian - Mexican Conference on asymptotic methods, applied mathematics and mechanics, Mexico, 1993 . ... Russian Journal of 4c. Mathematical Physics, 2, 1, 1994, . ... Russian Journal of 6 Mathematical Physics, 3, 1, 1995, . ... 1-3, 1998 .. Russian Journal of 4c. Mathematical Physics, 5, 2, . ...

Еще в разделе: (Показать все результаты (>38) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/koudr/publ.pdf

... Lomonosov Moscow State University . ... Home About Communication and Information Department . ... Our main areas of expertise are information exchange, building network partnerships, development of complex internet applications and solutions, implementing e-learning practices.б  . ... Dr. of Science (biology) Alexander O. Makeev Graduated from Geographic Faculty of Lomonosov Moscow State University. ... Alexander Ladygin graduated from department of Biology of Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>6) - ecfs.msu.ru/ )

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>16) - td.chem.msu.ru/ )

• Colloquium on 06.04.12 Laboratory of Chemical Thermodynamics
• Publications Laboratory of Chemical Thermodynamics
• PhDi Laboratory of Chemical Thermodynamics

... Brykina I. G. Methods for calculation of heat transfer and skin friction in 3D hypersonic laminar flow over bodies at all Reynolds numbers. ... Sakharov V. I. Simulation of nonequilibrium viscous gas flows in induction plasmatrons and over bodies. ... Shcherbak V. G. Numerical study of nonequilibrium air flow over bodies. ... Tirskiy G. A. Destruction of solid bodies in the hypersonic gas flow. ... Rusakov V. V. Analytical and numerical investigation of 3D viscous flow over blunt bodies. ...

Еще в разделе: (Показать все результаты (>6) - lab106.imec.msu.ru/ )

... BBK 22.6 G 12 UDK 37:[52+53] (076.1) G 12 Gavrilov M.G. / Zviozdnyj Mir: Sbornik zadach po astronomii i kosmicheskoj fizike. ... Here is volume IV – problems of the Olympiads of Scientific Centre in Chernogolovka (former Noginsk Scientific Centre). ... Russian introduction INTRODUCTION Olympiad for high schools students is one of interes- ting traditions of Chernogolovka: a small picturesque villa- ge not far from Moscow, in which the Scientific Center of the Russian Academy of Sciences is situated....

Еще в разделе: (Показать все результаты (>11) - www.issp.ac.ru/ )

• Institutes of Chernogolovka
• High Education in ISSP PAS, Chernogolovka
• Chair of MIPT in ISSP RAS, Chernogolovka

Some aspects of engineering solutions of ozonizer and ozone sensor. .. , . ... 30000 . ... Air ­ cooling for ozonizer is always simpler and cheaper than water ­ cooling. ... On the other hand it demands good adhesion between dielectric enamel and aluminium radiator. ... Discharge from needle allows generate ozone from non prepared air, but its efficiency is small. ... It is very reasonably to install little compressor in ozone sensor, which allows to inhale air probes from any narrow places. ...

Еще в разделе: (Показать все результаты (>25) - www.kge.msu.ru/ )

AFM studies of DNA condensation . ... Toroidal DNA-surfactant complexes on mica substrate . ... DNA molecules condensed in water-isopropanol media and deposited onto mica substrate . ... We carried out the set of AFM-studies of different DNA-condensation mechanisms in media with different polarity (aqueous solution, water-alcohol mixture, chloroform and so on). ... V.G. Sergeyev, O.A. Pyshkina, M.O. Gallyamov , I.V. Yaminsky , A.B. Zezin, V.A.Kabanov, DNA-surfactant complexes in organic media. ...

Еще в разделе: (Показать все результаты (>72) - www.spm.genebee.msu.ru/ )

• APPLICATION OF SCANNING PROBE MICROSCOPY TO THE STUDY OF DNA CONFORMATION
• List of my publications issued in 2003-
• Список моих публикаций в 1996-2002г.

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

... 6, 2011 A NEW NUMERICAL METHOD FOR THE SOLUTION OF THE BOLTZMANN EQUATION IN THE SEMICONDUCTOR NONLINEAR ELECTRON TRANSPORT PROBLEM N. A. Masyukov and A. V. Dmitriev UDC 538.935+517.958+537.84 Abstract. ... The method is based on the use of a mesh in the momentum space to represent the distribution function. ... Using this method, one can find the stationary distribution function as well as its time evolution. ... One can see that the distribution function is localized within the simulation area ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/rec-GaN.pdf
• http://lizard.phys.msu.su/home/science/rec-GaN.ps.gz
• http://lizard.phys.msu.su/home/science/Masyukov-Dmitriev-09-FPM-InN.pdf

... A high sensitive glucose amperometric biosensor based on Prussian Blue modified electrodes. ... Prussian Blue based first generation biosensors. ... The glucose amperometric biosensor was made by glucose oxidase immobilization onto a Prussian Blue-modified electrode with a Nafion layer. ... Glucose and alcohol biosensors were made by immobilisation of glucose oxidase and alcohol oxidase respectively, within a Nafion layer, onto the top of the Prussian-Blue-modified electrodes. ...

Еще в разделе: (Показать все результаты (>95) - www.enzyme.chem.msu.ru/ )

• Enzyme applications
• Biosensor Research Group
• products2

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>4) - astrometric.sai.msu.ru/ )

« PR » -, , .. , « PR » .. , PR () , , , , .. , , .. - , , , , TAP- , , « » , PR ( ) Jumeirah Group , digital director Saatchi & Saatchi Russia , Saatchi & Saatchi X , Trimetrix Solutions , , -, International PR Club , , International PR Club , «tutu.ru» , «» , «7 » , «1 . » , digital evangelist , PR- AR Door, 2010 " PR » , (: , , ) , account- « » , - , PR Aviareps AG

Еще в разделе: (Показать все результаты (>19) - ffl.msu.ru/ )

q| PDB : 1r51 :A| PDB : 1auz :A URATE OXIDASE FROM ASPERGILLUS FLAVUS COMPLEXED WI savkaarygkdnvrvykvhkdektgvqtvyEMTVCVLLEGEIetsytkadnsvivatdsikntiyitakq npVTPPELFGSILGTHFIEKYN-HIHAAHVNIVChrwtrmdidgkphphsfirdseeKRNvqvd------ ------vveGKGIDIKSSlsgltvlkstnsqfwgflrdeyttlketwdrilstdvdATWQW-------KN FSglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkhyfei dlswhkglqntgknaevfapqsdpnglikctvgrs t| PDB : 1auz :A| PDB : ...

Еще в разделе: (Показать все результаты (>229) - kodomo.cmm.msu.ru/ )

• Банк MedLine (PubMed)

... Alexander A. Moskovsky . ... Software Designer : . ... Projects: . Janitor II, Custodian III for Matrix Logic - utilities for DOCS Open EDMS (electronic document management system), C++/Win32 platform. ~2 man-year project with 5 persons team. iBuzz - (for ibuzz.com ) large client-server system (Win32, Enterprize Java Beans, Oracle, Sun/Solaris). ... Lunch Ordering Web System. ... Software Resources International , former Digital Moscow Software Center, . ... Physical Chemistry chair, . ...

Еще в разделе: (Показать все результаты (>8) - lcc.chem.msu.ru/ )

• People

Заседание 188 (16 мая 2008 г.) . Покровский И. Л. (МГТУ им. Баумана) О неограниченности решений краевых задач с нелокальными коэффициентами. ... При этом речь идет об обращении в бесконечность за конечное время нормы решения в некотором функциональном пространстве (так называемое blow-up solution). Доказательства основных утверждений опираются на свойства решений обыкновенных дифференциальных уравнений и неравенств, являющиеся следствиями теории дифференциальных неравенств Чаплыгина-Петровича. ...

Еще в разделе: (Показать все результаты (>35) - shamolin2.imec.msu.ru/ )

.. , . . , .. , , , , sociology of public administration, state regulation of economy, social state, social policy . . The article examines the role of the state based on the conclusions of the economic and sociological theories. It is noted the significance and necessity of the use of basic sociological categories and methods of sociological research to develop effective solutions to public policy and management.

Еще в разделе: (Показать все результаты (>9) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2013/3/06.pdf

Backlinks to VarMAKETEXT in System Web ( Search all webs ) . ... NEW - 06 Mar 2011 - 18:32 by ProjectContributor . ... Appendix A: Foswiki Development Time line Foswiki Release 1.1.9 19 Nov 2013 Foswiki 1.1.9 was built 18 Nov 2013. ... NEW - 19 Oct 2013 - 03:56 by ProjectContributor . ... Copyright by the contributing authors. All material on this site is the property of the contributing authors. Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>247) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) GoodStyle < System < Foswiki
• (backlinks in all Webs) JQueryTextboxList < System < Foswiki
• (backlinks in all Webs) FAQViewTemplate < System < Foswiki

... Question : When I press the microphone on button, the sensors volume indicators do not change. ... Answer : Try to do one of the following: . ... Check if the multi-sensor setup is turned on (the green indicator lights) . ... Check if the setup outputs are inserted in line input(s) of sound card(s) . ... Check if the sound recording from line inputs of both cards is turned on and the volume is set to some non-zero level. ... Go to the Basic Channels Setup property sheet of Options dialog . ...

Еще в разделе: (Показать все результаты (>41) - www.intsys.msu.ru/ )

• Installation

.. , . . , . , (e-mail: safonov@ulstu.ru) , , , crisis of the media, manipulation of consciousness, people and information . , . . The article is devoted to the problem of relationship between massmedia and auditorium. It is assumed that the very relationship went into deep crisis which seems to be becoming more sensitive. The author analyses the causes of the crisis and makes proposals to its solution.

Еще в разделе: (Показать все результаты (>11) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/03.pdf