... 3D magnetosphere . ... Data . ... Magnetosphere . ... Magnetic field at the selected point Module of the Magnetic field distribution along Sun-Earth line Noon-Midnight magnetosphere structure . ... Point coordinates, where magnetic field will be calculated: . ... Magnetic field at MD outer edge . ... Magnetic field at TC inner edge . ... Distance to external edge of MD . ... Distance to inner edge of MD . ... Magnetopause stand-off distance . ... Distance to inner edge of geotail current sheet . ...

Еще в разделе: (Показать все результаты (>1216) - swx.sinp.msu.ru/ )

• SWX - Прогноз Dst

... To define in detail the molecular mechanism of NAD+-dependent formate dehydrogenase, the pH dependences of various kinetic and spectroscopic parameters have been studied: Vmax, Km (NAD+), Km (formate), inhibition constants for structural analogues of substrate (NO3-) and product (CNS-, CNO-, N3-), CD and fluorescence properties. The value of Vmax, rate-limiting hydride transfer, is nearly constant throughout the entire pH range of enzyme stability (6.0-11.2) but decreases below 6. ...

Еще в разделе: (Показать все результаты (>143) - www.enzyme.chem.msu.ru/ )

... Архив семинаров . Авторы докладов . ... Послать приглашение на семинар . ... http://faculty.etsu.edu/yampolsky/ . ... Amino acid Exchangeability. Not all amino acid substitutions are made equal. ... Combining these data in a single amino acid substitution matrix allows to address some interesting questions bout protein evolution. ... Comparison of amino acid substitution patterns in proteins under different strength of stabilizing selection. ... Yampolsky. ... Научные семинары | ...

Еще в разделе: (Показать все результаты (>4133) - www.sevin.ru/ )

• JOINT ETHIO-RUSSIAN BIOLOGICAL EXPEDITION
• Laboratories: Laboratory for Ecology of Arid Territories: Goals and Tasks
• Laboratories: Group for Bioinformatics and Modeling Biological Process: Results

... Molecular Mechanics Calculations of beta-Diketonate, Aqua, And Aqua-beta-Diketonate Complexes of Lanthanide Ions Using Gillespie-Kepert Model . ... Abstract - A version of molecular mechanics based on the Gillespie-Kepert model of coordination bonds "repulsion" is applied to lanthanide complexes. ... For the aqua complexes, typical root-mean-square deviation (calculated vs. ...

Еще в разделе: (Показать все результаты (>22) - analyt.chem.msu.ru/ )

• The Molecular Mechanic Approach to Coordination Compounds: Force Field Based on
• Molecular mechanics study of the mixed-ligand lanthanide complexes using
• Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert

... Further processing Only 3N events of «good» runs of previous analysis are selected: 3N triggered events exist in every run Better accordance with MC for rates 150kHz (see elog 548 by Colas) GC triggered events excluded AaFit: -6.5 (Vladimir's presentation explains reason) Zenith angle 20° (in order to look only at events with vertical tracks) After 2008 2009 2010 all fi year year year ltres: -- 0.83107 -- 0.77107 -- 1.04107 - No evidence of possible anisotropy either. ...

Еще в разделе: (Показать все результаты (>22) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf
• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>39) - hpc.msu.ru/ )

• http://hpc.msu.ru/files/hpcmsu/downloads/X-Com_tutorial.pdf
• http://hpc.msu.ru/files/HPC/X-Com_tutorial.pdf
• CLEO: USER & ADMIN-FRIENDLY CLUSTER BATCH SYSTEM | Moscow University

... Basic statement: "Mathematics is much clever, than Mathematician" It means, that after the scientist or engineer developed new mathematical model and designed corresponding equations, the solution to these equations produces new information unpredictable for the author! ... This vibration excites the shear wave in tissue 2 sx 2 - (ct + ) s x = Fx 2 t t Studies in Fluid Dynamics of water jet are connected with two main problems: 1. Flows in contracting nozzle forming high-speed jet. ...

Еще в разделе: (Показать все результаты (>51) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/gusev_files/rao24-2.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/diff2012.pdf

... Preliminary evaluation of forest ecosystems' state near the smelter was made, the monitoring methodology for polluted areas was developed, and critical loads of acid deposition were assessed (see also soil.msu.ru/projects/acidification/ ). ... The new built up database on forest ecosystem data for permanent monitoring plots was used for analysis of soil chemical state in forest ecosystems subjected to airborne pollution in the fragile boreal environment in the Norwegian-Russian border area. ...

Еще в разделе: (Показать все результаты (>21) - eco.soil.msu.ru/ )

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>11) - iconolat13.phys.msu.ru/ )

• Submit a paper

... Subject : Marina Garadzha Farm Management Survey: Preliminary Results . ... Farm Management Survey: Preliminary Results Marina Garadzha 1. ... The second feature, the ability to efficiently manage farm assets and ensure profitability, depends on farm leadership and management capability. ... Who can aspire to manage efficiently these new farms under these new conditions? ... Who is efficiently farming? ... 2 Farm Management Survey: Preliminary Results/Garadzha Russian Land Privatization Project 13 ....

Еще в разделе: (Показать все результаты (>155) - www.fadr.msu.ru/ )

• Proposition

... Rod unfortunately was not able to come to Garmisch this year, but has been in touch with the Russian Internet community in Seoul, Sharm el Sheikh, Nairobi, and the United States, and has sent a special letter to Vladislav Petrovich. ... ICANN is working with regional associations and the Internet Society in a global training program that is raising the security awareness and skills of those DNS operators in regions where resources for such training are limited. ...

Еще в разделе: (Показать все результаты (>3) - www.iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2010/vaish_ea.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... These peculiarities allowed us to perform noncontact recognition of salt type and determination of salt concentration in water solutions by means of artificial neural networks. ... In Fig. 2, one can observe the behavior of the water Raman spectra in the solutions with the same concentration of the salts with different anions and the same cation K+. ... The method of determination of the concentration of salts dissolved in water (including water salinity) is based on this fact. ... Table 1. ...

Еще в разделе: (Показать все результаты (>23) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/Assets/Water/PatRec2007.pdf
• http://rswater.phys.msu.ru/Assets/Water/J_Phys_ChemC_2012.pdf
• http://rswater.phys.msu.ru/en/articles/2014/Application.pdf

... RELEC Mission: Relativistic ELECtron Precipitation and TLE Study on-board Small Spacecraft . ... Spacecraft mass: 283 kg. ... The Program of RELEC workshop July, 28, 29, Moscow more details.. ...

Еще в разделе: (Показать все результаты (>4) - vernov-relec.sinp.msu.ru/ )

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>4) - ccoe.msu.ru/ )

... Полная версия этой страницы: Higgs boson lighter than previously predicted . Студенческий форум Физфака МГУ > Наука физика > Другое . ... The new W-mass value leads to an estimate for the mass of the yet-undiscovered Higgs boson that is lighter than previously predicted (<114 ГэВ, см. картинку ниже, доверительный интервал 68%) , in principle making observation of this elusive particle more likely by experiments at the Tevatron particle collider at Fermilab. ...

Еще в разделе: (Показать все результаты (>1022) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > семинар Г. т'Хофта в Стекловке
• Студенческий форум Физфака МГУ > Theoretical PhD studies
• Студенческий форум Физфака МГУ > Theoretical PhD studies, PhD positions for

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>7) - margaret.imec.msu.ru/ )

• Education
• Air-Permeability Influence on Pressure Distribution Character
• On Square Parachute Differential Equations

... solvation nucleation of the polymorphs Solute-solute interactions, association parameters , thermodynamics parameters , conformations growth of the crystal Nature of solvent, intermolecular interactions (solute ­ solvent, solute-solute), conformations Lattice energy , entropy of the crystal, symmetry of the lattice, conformations The conformational manifolds is the candidate to be a coordinate of reaction Methods of investigations Quantum chemistry ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/basilevsky.pdf
• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf

... We are pleased to inform you that Federation of European Societies of Plant Physiology (FESPP), Russian Academy of Sciences (RAS), Ministry of Education of Russian Federation, Division of Physico-Chemical Biology RAS, Russian Society of Plant Physiologists, Scientific Council of Plant Physiology and Photosynthesis RAS, K.A.Timiryazev Institute of Plant Physiology RAS and Russian Peoples' Friendship University are ... Lev N. Andreev (Moscow, Russia) . ... TUESDAY, OCTOBER, 23rd ...

Еще в разделе: (Показать все результаты (>165) - herba.msu.ru/ )

• Moscow State University, Geobotany dpt. - Courses
• Heterogeneity in Northern Russian Alders
• Materials on White sea islands

... PROJECT 01-0172 . Dynamic processes in amorphous glassy polymers and their effect on gas transport: theoretical, experimental and simulation studies . ... The main goal of this Project is to study a influence of chemical structure of the polymer unit on the gas transport parameters by the methods of the conformational analysis , method Monte Carlo and molecular-dynamic method. ... Theoretical and simulation methods will be used for study of gas transport of glassy polymers . ...

Еще в разделе: (Показать все результаты (>157) - polly.phys.msu.ru/ )

• Science
• CURRICULUM VITAE