... Department of Chemical Enzymology, School of Chemistry, Lomonosov Moscow State University, Moscow, 119899, Russia. ... The mapping of the fragments was done using a model structure of horseradish peroxidase. Five of six structurally similar fragments belong to the distal domain and form a subdomain in plant peroxidases that includes the distal heme-coordinating sequence, LHFHDC (amino acid residues 39-44 in horseradish peroxidase). ...

Еще в разделе: (Показать все результаты (>102) - www.enzyme.chem.msu.ru/ )

• products3
• Abstract

OldFonts FONT PACKAGE The package gives a LaTeX user access to several traditional Russian font families used for book typesetting. ... Fonts contain modern Russian characters as well as those used in the 19th century Russian writing. The package also contains supplementary files that allow use of "Adobe Minion Pro" and "Palatino Linotype" font families with LaTeX. ... So all documentation is written in Russian. ... A.V.Dmitriev, 4 June, 2006. http://lizard.phys.msu.su, http://lizard.phys.msu.ru ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/compu_sci/oldfonts-eng.html
• Condensed Matter Theory: Index

... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>43) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics
• MSU-LGCLL:: Krylov J.K.- Three Laws of Fiction Prosaic Texts Organization
• О Лингвоанализаторе 3-эпсилон

Diploma thesis abstract by Rumiantsev Yuri Temperature dependence of refraction index and absorption factor dynamics of azobenzene containing polymer layer This diploma paper work features temperature dependence of refraction index and absorption factor dynamics of azobenzene containing polymer layer. ... Basing on this model and experimental results the absorption cross-sections of trans and cis isomers and rotary diffusion factor of trans isomers have been calculated. ...

Еще в разделе: (Показать все результаты (>33) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Grigoriev_Makarov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Semenov_Shlenov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Shchepetov_Romanovsky_en.pdf

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt

THE 75th NAME-LIST OF VARIABLE STARS. ... The 75th Name-List consists of two tables. ... the literature, taken from positional catalogues, including USNO A1.0/A2.0 and GSC, or determined by the authors); the range of variability (sometimes the column Min gives, in parentheses, the amplitude of light variation; the symbol ( means that the star , in minimum light, becomes fainter, than the magnitude indicated); and the system of magnitudes used ( P are photographic ...

Еще в разделе: (Показать все результаты (>14) - www.sai.msu.ru/ )

• The Catalogue of Interacting Galaxies by Vorontsov-Velyaminov
• Moscow Astronomical Plate Archives: Contents, Digitization, Current and

BioSystems 90 (2007) 340­349 Physical limits of computation and emergence of life Abir U. Igamberdiev Department of Plant Science, University of Manitoba, Winnipeg, Manitoba R3T 2N2, Canada Received 14 July 2006; received in revised form 18 September 2006; accepted 21 September 2006 Abstract The computational process is based on the activity linking mathematical equations to a materialized physical world. ... Quantum computation, non-demolition measurements, and reflective control in living systems. ...

Еще в разделе: (Показать все результаты (>282) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/igamberdiev_objective.pdf
• Laboratory-chair of modelling the natural references of time
• Pic. 3.

... Available trees in the HiForest : hiEvtAnalyzer/HiTree - Event property tree. ... Pb-Pb (2.76 TeV): /eos/ cms /store/group/phys_heavyions/icali/MinBias_Merged.root ( https ://twiki.cern.ch/twiki/ bin /viewauth/ CMS /HiForest#Data ) P-Pb (run 202792): /afs/cern.ch/user/t/tuos/work/public/pPb/Data/ PAPhysics-pt01-full_WithCentrality.root ( https ://twiki.cern.ch/twiki/ bin /viewauth/ CMS /PPbCentralityAna , https ://twiki.cern.ch/twiki/ bin /viewauth/ ...

Еще в разделе: (Показать все результаты (>25) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~igor/seminar/fotina_lomonosov.pdf
• http://lav01.sinp.msu.ru/~igor/seminar/ZZlav01_seminar.pdf

Математическое моделирование группы погребенных контейнеров с отходами. Mathematical modeling of an array of underground waste containers / Bourgeat Alain, Gipouloux Olivier, Marusic-Paloka Eduard // C. r. Mec. Acad. sci., Paris, 2002. ... С. 371-376. ... Рассматривается математическая модель, описывающая поведение контейнерного хранилища жидких отходов в момент начала утечки. ... математическое моделирование, отходы, численный расчет . ...

Еще в разделе: (Показать все результаты (>9) - ecoinformatica.srcc.msu.ru/ )

• http://ecoinformatica.srcc.msu.ru/print_html.php?keyword=&num_records=1&theme=6&subtheme=30&from=&ref_ind=0502002728

... J. 17(1): 7172 ї RUSSIAN ENTOMOLOGICAL JOURNAL, 2008 An unusual larval habitat for Culicoides arboricola (Root & Hoffman) (Diptera: Ceratopogonidae) in the Florida Keys, USA Необычное местообитание личинок Culicoides arboricola (Root & Hoffman) (Diptera: Ceratopogonidae) на островах Флорида Киз, США Lawrence J. Hribar Лоуренс Дж. ... E-mail: gringo1122@hotmail.com KEY WORDS: Culicoides arboricola, Ceratopogonidae, larval habitats, new record, Florida. ... 2004; Grogan & Hribar, 2006]. ...

Еще в разделе: (Показать все результаты (>780) - zmmu.msu.ru/ )

• Pleistocene Canidae (Mammalia, Carnivora) from the Paleolithic Kudaro caves in
• Russian Journal of Theriology

проекты . ... летняя школа . онлайн проекты . ... школа ?1951 . сайт: http://schools.keldysh.ru/sch1951/1951/default.htm . ... наших курсов . ... курсы . Microsoft . ... Oracle . ... IBM . Подготовительные курсы МГУ || помощь студентам || олимпиады || проекты . ... курсы Microsoft || курсы Oracle || курсы IBM || . ... НОУ "УНИВЕРСИТЕТСКАЯ МАТЕМАТИЧЕСКАЯ ШКОЛА", 1995-2016 . ...

Еще в разделе: (Показать все результаты (>4) - www.fizmatclass.ru/ )

Главная Международные связи Партнерские университеты . ... http://www.gsm.pku.edu.cn/default_en.html . ... http://gsb.skku.edu/ . ... http://cba.snu.ac.kr/en . ... http://www.smu.edu.sg/ . ... http://www.aoyamabs.jp/eng/index.html . ... http://www.nucba.ac.jp/en . ... http://www.waseda.jp/fcom/soc/en/about . ... http://www.ebs.ee/ . ... http://www.kaizen.com/ . ... http://www.lse.ac.uk/ . ... http://queensu.ca/bisc/home . ... http://www.bi.edu/ . ... http://www.usc.edu/ ; http://www.marshall.usc.edu . ...

Еще в разделе: (Показать все результаты (>38) - www.mgubs.ru/ )

... Форумы > Абитуриентам > Тема . Автор темы ohfortuna . Форумы Список тем Новая тема . 02.06.2011 17:06 . ohfortuna . ... Перевод из Беларуси . ... Возможно ли перевестись из мехмата БГУ http://www.mmf.bsu.by/Default.aspx?tabid=76 на ваш мехмат? ... Хотелось бы перевестись на 3 курс на бюджет, реально ли это? ... Следующая тема Предыдущая тема . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>40) - www.mmonline.ru/ )

• MMOnline | Форумы | Разное | Еще раз ЭВМ
• MMOnline | Форумы | Разное | Перевод из Беларуси

Title Author Key words Genesis of the Russian Empire's geopolitical strategy in the Pacific region (1724­1917) Kovaleva A.O. geopolitics, geostrategy, Pacific region, expansion, frontier, exploration The article considers the genesis' peculiarities of the Russian Empire's geopolitical strategy in the Pacific region. Geostrategy is defined, its main components distinguished. Geostrategy is divided into external (expansion) and internal (organization of the territory of the state). ...

Еще в разделе: (Показать все результаты (>22) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/02.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

Elena Ardashnikova, PhD . ... Ардашникова Е.И., Борзенкова М.П., Новоселова А.В., Изучение системы KF-DyF 3 // Изв. ... Свищев И.М., Ардашникова Е.И., Борзенкова М.П. Новоселова А.В., Способ определения глубины протекания пирогидролиза во фторидах металлов//Авторское свидетельство ?1122963 от 8 декабря 1983, Б.И. ?41, 1984 г. Фадеева Е.Е., Ардашникова Е.И., Поповкин Б.А., Борзенкова М.П., Проблемы фторирования оксидных ВТСП// Ж. неорган. химии, 1993, т.38, ?3, с.389-398. ... 2000, V . ...

Еще в разделе: (Показать все результаты (>27) - www.inorg.chem.msu.ru/ )

• I n o r g a n i c C h e m i s
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds
• Prof. Dolgikh group. Publications 2009

Early physics with Atlas at LHC Bellisario Esposito (INFN-Frascati) On behalf of the Atlas Collaboration Outline З З З З З З Atlas Experiment Physics goals Next LHC run conditions Physics processes observable with early data In-situ detector calibration with collision events Early measurement of physics processes Conclusions 14th Lomonosov Conference on Elementary Particle Physics Moscow , 19 August 2009 1 ... Discover a Z' up to masses of ~ 1 TeV ? ...

Еще в разделе: (Показать все результаты (>84) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/1996_7.pdf
• http://nuclphys.sinp.msu.ru/mirrors/1968_6b.pdf

News of PARALLEL.RU par-news на mail.parallel.ru . ... НОВОСТИ МИРА ВЫСОКОПРОИЗВОДИТЕЛЬНЫХ ВЫЧИСЛЕНИЙ http :// parallel.ru / news / + По инициативе совместного центра МГУ-Интел сотрудники нижегородского отделения компании Интел провели в НИВЦ МГУ однодневный ... пользователей суперкомпьютерного комплекса СКИФ МГУ ЧЕБЫШЕВ средствам и инструментам разработки параллельных программ. http :// parallel.ru /russia/MSU- Intel /training.html + 3-5 марта в Тайване состоялась конференция HPC Asia ...

Еще в разделе: (Показать все результаты (>7) - mail.parallel.ru/ )