A full system of equilibrium differential equations for the finite number of suspension lines (n = 28) of square parachute is derived. ... One can determine the shapes of inflated canopy radial cross-sections, stress distribution of radial ribbons on the canopy surface and fabric stress between them, drag coefficients for various line lengths and air-permeability by means of computer simulation. ... Initially, this problem was solved assuming D p = const over total canopy of square parachute. ...

Еще в разделе: (Показать все результаты (>7) - margaret.imec.msu.ru/ )

Model Answer This model answer has been written by an examiner as an example of a very good answer. However, please note that this is just one approach out of many possible ways. ... The author considers two solutions for/to the task: empirical (experimental) and geometric (hypothetical, theoretical). The article goes on to say that there is, actually, a simple way of ultimate connection. ... The height values of the two tilings differ in one flip in the centre of the hexagon. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/theses3.pdf
• http://www.eng.math.msu.su/download/section_1.pdf
• http://www.eng.math.msu.su/download/section2.pdf

... Abstracts . ... Accomodation . ... Experiments and models. The connection between them is the reflection of model characteristics on the class of measurable quantities: positions of spectral bands and lines. ... Models ambiguity. ... Modern design methods (modern methods of calculation). Quantum beatings. abstract (PDF) . 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>89) - www.msm.biophys.msu.ru/ )

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>71) - mouse.belozersky.msu.ru/ )

• Alignment example
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

PRL 105, 016001 (2010) PHYSICAL REVIEW LET TE RS week ending 2 JULY 2010 Random- Roughness Hydrodynamic Boundary Conditions Christian Kunert,1 Jens Harting,2,1 and Olga I. Vinogradova 1 2 3,4 Institute for Computational Physics, University of ... published 30 June 2010) We report results of lattice Boltzmann simulations of a high-speed drainage of liquid films squeezed between a smooth sphere and a randomly rough plane ... Squares are the results measured for a rough wall ( М 4%, r М 10x). ...

Еще в разделе: (Показать все результаты (>61) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/derjaguin.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2006e.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf

New achievements in Development of Multidimensional Data Acquisition, Processing and Visualization DAQPROVIS M. MorhА *, 1, 2 , V. Matousek 1, 2 1, 3 , J. Kliman 1, 2 , 1 Institute of Physics, Slovak Academy of Sciences, Bratislava, Slovakia 2 Flerov Laboratory of Nuclear Reactions, JINR, Dubna, Russia 3 Laboratory of High Energies, JINR, Dubna, Russia * E-mail: morhac@savba.sk ACAT - 2002 I. Turzo c 1, 3 , . ... The channels are displayed as balls. ... Four-parameter experimental spectrum. ...

Еще в разделе: (Показать все результаты (>60) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/nikitin/posterACAT2002.doc
• http://acat02.sinp.msu.ru/presentations/medvedeva/Article.doc
• http://acat02.sinp.msu.ru/poster-sessions.html

... Printed in the UK PII: S0022-3727(00)13723-4 Surface segregation of transition metals in sol ­gel silica films V B Prokopenko, V S Gurin§, A A Alexeenko , V S Kulikauskas and D L Kovalenko Advanced Materials Laboratory, Gomel State University Silica sol­gel films (SGFs) doped with various transition metals derived by spin-coating on glass substrates and silicon wafers have been studied. ... Remarkable segregation of metals at the surface was observed for films doped with Cu and Co. ...

Еще в разделе: (Показать все результаты (>126) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LINT/NIMB270_2012_P50.pdf
• http://danp.sinp.msu.ru/ACS_pdf/atcol_1.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>12) - mph.cmc.msu.ru/ )

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50љnm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>91) - nanolab.phys.msu.ru/ )

• Nanophotonics of surface states in photonic crystals | Laboratory of

... Basic server procedures are dedicated to homology (similarity) search of sequence and 3D structure of proteins. The homologies found could be used to build multiple alignments, predict protein and RNA secondary structure, and construct phylogenetic trees. ... KEY WORDS: mathematical and statistical biology, biological sequences databanks, macromolecular algorithms, sequence homology, sequence alignment, RNA secondary structure, protein secondary and tertiary structure, protein structure alignment. ...

Еще в разделе: (Показать все результаты (>249) - www.genebee.msu.ru/ )

• Biochemistry (Moscow), Vol
• GeneBee
• GeneBee service

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>4) - oc.cs.msu.ru/ )

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>68) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Intelligent Systems :: Staff :: Zolotykh Andrej Alexeevich
• Intelligent Systems :: Research

О лаборатории . ... Лаборатория теоретической биофизики . ... Download script: memgen-0.0.1.tar.gz System requirements: python 2 (2.6 and higher), python openbabel library, python numpy library. ... continue reading..... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>60) - erg.biophys.msu.ru/ )

• Constructing discrete Laplacian via sparse matrix ERG Research Group:
• python ERG Research Group: Лаборатория теоретической биофизики
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики

... 209 Regular Maps on Non-orientable Surfaces MARSTON CONDER and BRENT EVERITr Department of Mathematics, University of Auckland, Private Bag 92019, Auckland, New Zealand (Received: 12 April 1994; revised version: 20 June 1994) Abstract. It is well known that regular maps exist on the projectiveplane but not on the Klein bottle, nor the non-orientable surface of genus 3. ... Despite this apparent evidence to the contrary, regular maps do exist on most non-orientable surfaces. ...

Еще в разделе: (Показать все результаты (>72) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/papers-sym/brahana.pdf
• http://dfgm.math.msu.su/files/0articles/Kudryavtseva/rd_4_53.pdf
• http://dfgm.math.msu.su/files/0articles/Zheglov/GTM.pdf

... Consider a matrix S. The element sij of S is equal to the number of inextendible directed sequences from the minimal vertex i to the maximal vertex j . ... Therefore the number of directed sequences from the vertex i to the vertex j is equal to the element wij of a matrix W: N W= k =0 V k , (1 9 ) 6 where N is equal to the number of edges in the graph. ... Tr S is equal to the number of inextendible directed sequences from minimal vertexes to maximal vertexes that have equal numbers. ...

Еще в разделе: (Показать все результаты (>17) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_discreet-mechanics.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_unfaithful.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_a-sequential-growth.pdf

What would you like to search for? ... Case sensitive Match whole word Recent publications first . ... What to do if you are looking for ... words iron and oxide in the same record: iron and oxide . both these words or chemical formulae: (iron and oxide) or Fe2O3 . ... That's why do not use Co instead of cobalt : you will find Co even in al co hol! ... The hidden part of the database allows you to use full names of chemical elements instead of the short ones (like nickel instead of Ni ). ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

THE THIRD ANNUAL STUDENTS' SCIENTIFIC CONFERENCE ON TODAY'S TOPICAL POLITICAL AND PHILOSOPHICAL ISSUES Panel of philosophy ALEXANDER BOURGANOV AND HIS `NEW ROMANTICISM' CONCEPTION Liyamina Anastasiya Faculty of philosophy 1st year student Alexander N. Bourganov occupies an important place among famous masters of modern sculpture. ... He tries to find philosophical foundation for mathematics. ... Existential dread is examined by Kierkegaard in his work "The concept of anxiety". ...

Еще в разделе: (Показать все результаты (>57) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/publications/komarova/komarova-the-earth-and-its-people.pdf
• http://www.ffl.msu.ru/students/courses/linguistics-and-icc/15-kicheva-praktikum-mkk.pdf

F1 ATPase NANO MOLECULAR MOTOR DYNAMICS DIPLOMA THESIS ABSTRACT Bulushova L.S. F0F1 ATPase nano-mo lecular motor dynamics is analyzed in the present paper. This nanomo lecular motor converts chemical energy into rotation energy of rotor ( subunit)­ the main part of F0F1 ATPase or vice versa. F1 ATPase is a part of the motor and it can work and transform energy independent ly. ... Kinemat ic links between an angle of the rotor turn and subunit closure angle are achieved. ...

Еще в разделе: (Показать все результаты (>135) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Voronov_Ponomarev_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Kostylev_Cherezova_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2011/Mukhin_Shkurinov_en.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Carbamide Laboratory of Chemical Thermodynamics