... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...
[
Текст
]
Ссылки http://www.fbm.msu.ru/upload/conf/20110201/Information_letter_2011_eng.pdf -- 232.1 Кб -- 11.10.2010
[
Текст
]
Ссылки http://fbm.msu.ru/upload/conf/20110201/Information_letter_2011_eng.pdf -- 232.1 Кб -- 11.10.2010 Похожие документы
Geographic Population Structure (GPS) of worldwide human populations infers biogeographical origin down to home village Eran Elhaik and Tatiana Tatarinova The search for a biogeographical method that utilizes biological information to predict one's place of origin has occupied scientists for millennia. ... GPS's accuracy is demonstrated on three datasets: worldwide populations, Southeast Asians and Oceanians, and Sardinians (Italy) using 40,000 -130,000 GenoChip markers. ...
[
Текст
]
Ссылки http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/153.pdf -- 97.1 Кб -- 07.05.2013 Похожие документы
Luria's ideas in East and West Johnson J.J. Boston University, Department of Psychology, USA, Boston jjjohnson@mail.boston.com Luria's life embodied a contradict ion between personal conformism and intellectual dissent. ... Yes No Luria's ideas in East and West Presentation Boston Universit y, Department of Psycho logy Boston Universit y, Department of Psycho logy USA Boston 02215 Boston Universit y, One Silber Way, Boston, MA 02215, USA +1(617)3532000 +1(123)4567890 jjjo hnson@mail. boston.com Yes ...
[
Текст
]
Ссылки http://www.psy.msu.ru/science/conference/luria/2012/example_en.pdf -- 92.1 Кб -- 02.04.2012 Похожие документы
Conference . ... 3rd Announcement . 2nd Announcement . ... The 2006 autumn IVOA Interoperability Meeting and Small Project Meeting will be held in Moscow, Russia, from September 18-22. The venue for the meeting are Institute of Astronomy, Sternberg Astronomical Institute and Headquarter of the Russian Academy of Sciences. ... Working Groups: VOTable, UCDs, Registry, Data Models, Data Access Layer, VO Query Language, Grid and Web Services, and VOEvent. Interest Groups: Applications, Theory. ...
Apache2 Ubuntu Default Page . It works! This is the default welcome page used to test the correct operation of the Apache2 server after installation on Ubuntu systems. ... Ubuntu's Apache2 default configuration is different from the upstream default configuration, and split into several files optimized for interaction with Ubuntu tools. ... The configuration layout for an Apache2 web server installation on Ubuntu systems is as follows: /etc/apache2/ |-- apache2.conf | ... Document Roots . ...
XIV International Ornithological Conference of North Eurasia 2nd Information Letter Dear colleagues! Conference Committee acknowledges that XIV International Ornithological Conference of North Eurasia will take place on 18-24 August 2015 in Almaty (Kazakhstan), hosted by Al-Farabi Kazakh National University. ... Registration forms and abstracts with the proposed status of the presentation (sectional presentation or poster) are still welcomed up to 1 December 2014. ...
[
Текст
]
Ссылки http://zmmu.msu.ru/menzbir/Almaty2015/2%20Letter%20-%20Almaty%202015%20ENG.doc -- 54.5 Кб -- 30.10.2014 Похожие документы
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
... About CIE MSU . Academic Programmes . ... Vestnik CIE (in Russian) . FAQs (in Russian) . ... About Moscow University . ... Cultural Programmes and Excursions . No educational course at our Center would be complete without introduction to Russian cultural and historical heritage and Russian national traditions. ... We arrange a variety of sightseeing tours around Moscow and Moscow area, as well as excursions to famous Moscow museums and trips to other Russian cities and historical places. ...
. Lab . Main page News People . ASA . Master . Master net Homepage . Login . SAI MSU . Conference was supported by PLC "MO "OPTIKA" . English Русский . Homepage . Programme . Announcements . Participants . Gallery . SOC & LOC . Contacts . 1st Announcement . International workshop "MASTER Global Robotic Net" devoted to the 10th anniversary of "MASTER" project will take place in Moscow, Russia, August 13-18 2012.
... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...
... Brazilian Journal of Microbiology [Braz J Microbiol] . Common information . ... since 2000-01-01 till today . ... biology ->microbiology . ... Replacing the Revista de Microbiologia . ... Sociedade Brasileira De Microbiologia . ... http://www.scielo.br/scielo.php?scrip.. ... 2000-01-01 . today . ...
XMCQDPT (Extended Multi-Configuration Quasi-Degenerate Perturbation Theory) is the new approach to Multi-State Multi-Reference Petrurbation Theory developed by Dr. Alexander A. Granovsky of Firefly Proejct. ... XMCQDPT2 (XMCQDPT at second order of PT expansion, referred as MC-XQDPT2 in some older publications) is superior to MCQDPT2 and is aimed to completely replace MCQDPT2/DETPT2 calculations in the future. ... Fast Two-electron Integral Code . ... PC GAMESS/Firefly' NBO code . ...
. As you probably have seen, the star in my original image is not nova. When I looked images from others, I noticed, that the star which i marked for nova in my image, is really a very faint doublestar. After more processing for my original image and compared it with Lick Observatory discovery image the real nova is now excatly in the right place. (Sept 4th, 1998) Marko Moilanen . Back to Supernovae in NGC and IC galaxies. David Bishop Last modified: Thu Sep 10 09:27:24 EDT 1998
You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...
... For students . ... 25 February 2016 We congratulate Plastinin Ivan and Vervald Alexey who have become PhD students! 25 January 2016 We congratulate Kirill Laprinskiy who won scholarship of M.V. Lomonosov for the young scientists! ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...
... Society . ... Library . ... In the course of science popularization program MOIP shall set up a project called ?Public Lecture Hall?. In the course of the project holding we shall have meetings to be held as public lectures with our country?s scientists. ... In October 2015, the Society?s members, . ... We are working on the restoration and digitaziation of the Moscow Naturalist Society library. This will allow to avoid readers? direct contact.љ ... 2015 Moscow Society of Naturalists . ...
Sergei Kulik . ... Department of Quantum Electronics, Faculty of Physics, M.V.Lomonosov Moscow State University, Leninskie gory, 1, str.2, Moscow 119992, GSP-2, Russia, . ... 1986 Graduated from M.V.Lomonosov Moscow State University; . 1991 Ph.D. in M.V.Lomonosov Moscow State University; . ... 2006 - M.V.Lomonosov Moscow State University, . Department of Quantum Electronics, Faculty of Physics, Head of Quantum Information lab . 2003 - M.V.Lomonosov Moscow State University, . ...
Alexander Dmitrievich Ryabov . ... Place of Birth: Moscow, Russia (USSR) . Higher Education - Department of Chemistry, Moscow State University, Russia . ... 1976 - Graduated the Department of Chemistry, Moscow State University . ... Professor of Chemistry, Division of Chemistry, G. V. Plekhanov Russian Economic Academy, Moscow, Russia; February 1989 -; Professor of Chemistry, Division of Chemical Enzymology, Department of Chemistry, Moscow State University; Moscow, Russia; September 1993 - . ...