... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>41) - www.bukivedi.ru/ )

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... Scientific equipment . ... July 8, 2012 . ... May 10, 2012 . The entrance control of cable system of scientific equipment ?Lomonosov? successfully completed. ... Input control tests of scientific equipment ?Lomonosov? devices is held in NIIEM. December 15, 2011 . Preparations for testing the dynamic module of scientific instruments for satellite ?Lomonosov? is finished. November 30, 2011 . ...

Еще в разделе: (Показать все результаты (>26) - lomonosov.sinp.msu.ru/ )

• Mikhail Lomonosov ? the Pioneer of Russian Science | Университетский спутник

... A hybrid heuristic parallel method of global optimization" . ... A hybrid heuristic parallel method for solving of complicated global optimization problems is proposed. ... The method is compared with 21 modern methods of global optimization and with a genetic algorithm using 28 test objective functions of 50 variables. Keywords: global optimization, heuristic methods, neural networks, parallel computing, C++, MPI. ...

Еще в разделе: (Показать все результаты (>254) - num-meth.srcc.msu.ru/ )

• "Special stochastic representation of quantum mechanics and solitons"
• "A practical approach to the interaction between a computing cluster monitoring
• "Application of parallel programming tools for the solution of fluid dynamics

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>8) - td.chem.msu.ru/ )

• PhDi Laboratory of Chemical Thermodynamics

Unity in the name of the Higher School I.B. Fedorov, Chairman of Rectors' Council of Moscow and Moscow Region, Rector of Moscow State Bauman Technical University, Corresponding Member of Russian Academy of Sciences. ... They help to think anew those events, which are still extremely important many years later. ... Even more, inside the higher school itself, skeptical mood prevailed at that time - just another senseless organization to waste time and efforts. ...

Еще в разделе: (Показать все результаты (>31) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/274.doc
• http://www.rsr-online.ru/doc/norm/396.doc
• http://www.rsr-online.ru/doc/norm/526.doc

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index . FemtoScan `` client-program has a number of additional commands to work with during scanning. These commands allow to execute some special operations on microscope control and interface configuration. ... Fast probe landing and retraction . ... Images saving mode . ... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>138) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• DNA-surfactant complexes in organic media
• Features searching

Example of Divergent Fourier Series over Rearranged Walsh-Paley System / Polyakov I.V. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>137) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Instructions
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 4/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2012

Форум МГУ Главная Помощь > . ... BB-коды . ... Делает выделенный текст полужирным, наклонным, подчеркнутым или зачеркнутым. Пример: . Это [B]полужирный[/B] текст. ... Вывод: . ... Изменяет цвет, шриф или размер выделенного текста. ... Создать ссылку из выделенного текста. ... URL]http://www.example.com[/URL] . ... Делает выделенный текст ссылкой на интернет-страницу или адрес e-mail. ... Показывает картинку, используя выделенный текст как URL . ... Увеличивает отступ выделенного текста. ...

Еще в разделе: (Показать все результаты (>24) - osk.msu.ru/ )

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... The Dynamics of Systems with Servoconstraints. ... The presence of symmetries allows one to reduce the dynamic equations to a closed system of differential equations with quadratic right-hand sides on a Lie algebra. ... If v (x) = 0 for x = 0, then the system (3.1) admits an invariant straight line x = , where is a nonzero vector from Rp and the parameter changes with time according to the differential equation = c2 , c = 0. ... Theorem 2. ...

Еще в разделе: (Показать все результаты (>135) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/972/RCD752.pdf
• http://ics.org.ru/upload/iblock/38e/121-euler-poisson-equations-and-integrable-cases_ru.pdf
• http://ics.org.ru/upload/iblock/0cd/RCD232.pdf

... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>14) - ferro.phys.msu.ru/ )

• Special courses for the students of Physics Faculty, specialized at the...

... Новости . ... Материалы . ... Аспирантура . ... О проекте . ... Если у вас не получается скачать что-нибудь с нашего FTP сервера, то вам необходимо включить passive mode в вашем FTP клиенте. ... Файлы с учебными материалами опубликованные . ранее вы можете скачать с нашего ftp сервера . ... 6 монет, 2 фальшивые . ... 21 июня Магистратура мехмата МГУ проведет День открытых дверей . ... Сайт работает с 29.08.2000, Copyright 2000 2010 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>508) - www.mmonline.ru/ )

• MMOnline | Форумы | Обсуждение сайта | To webmasters: HELP !!!
• MMOnline | Форумы | Разное | Когда начинается учеба в весеннем семестре?

... The optimal control, which led oscillatory system to a certain energy level from any initial conditions at minimum time, is found. ... A set of points where the trajectory becomes an arc of a circle with the other center is called the switching line. ... For drawing switching line near the origin (see for example Figure 3) we note from the system (1) that time is proportional to the sum of the angles 214 this sums for optimal and quasi-optimal processes. ... The control function (14) is not optimal....

Еще в разделе: (Показать все результаты (>12) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/0910.3802.pdf
• http://belyakov.imec.msu.ru/papers/ENOC2008.pdf
• Anton O. Belyakov

... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker­Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation-propagation directions. The coefficient of angle diffusion is calculated using the Mie theory. The equation is solved numerically using the stochastic analog method, and the space and angle distribution of the radiation that passed through the diffuser is calculated. ...

Еще в разделе: (Показать все результаты (>17) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/Dmitriev-Ivanov-Xoxlov-09-FPM-Diffuser.pdf

ARRAYS FOR TENSOR MEASUREMENTS OF THE ELECTRIC FIELD Aleksandr Mousatov, Mexican Petroleum Institute, Mexico E-mail: amousat@imp.mx Evgueni Pervago, Mexican Petroleum Institute, Mexico E-mail: epervago@imp.mx Vladimir Shevnin, Mexican Petroleum Institute, Mexico, E-mail: vshevnin@imp.mx Abstract The study of resistivity anisotropy in heterogeneous media is a complex problem that needs developing the special field technology and interpretation technique. ... L is the array spacing. ...

Еще в разделе: (Показать все результаты (>73) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>2) - seyranian.imec.msu.ru/ )

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>77) - qilab.phys.msu.ru/ )

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years – for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>44) - eng.geogr.msu.ru/ )

• Recreational Geography and Tourism
• Department of Landscape Geochemistry and Soil Geography