... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>160) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening by similarity
• screening by keywords

... education . research . ... This talk will focus on one of the emerging technology for solar light conversion into electricity; the dye-sensitized solar cell. ... The present lecture will give a general background to the solar energy field with a focus on dye-sensitized solar cells. ... С докладом Dye-sensitized Solar Cells Materials and Interfaces выступил профессор Lars Kloo из Королевского технологического института г. Стокгольма. ...

Еще в разделе: (Показать все результаты (>16) - nano.msu.ru/ )

• Dye-sensitized Solar Cells ? Materials and Interfaces | Научно-образовательный

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>22) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |
• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>375) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• Time as a function of a biological system
• GEOMETRY, TIME AND THE LAW OF CONTINUITY

Book Review Struct Multidisc Optim 28, 372 ­ 373 (2004) DOI 10.1007/s00158-004-0451-7 A.P. Seyranian and A.A. Mailybaev: "Multiparameter Stability Theory with Mechanical Applications" World Scientific Publishing Co. ... A remarkable feature of the book is the authors' presentation of a new multiparameter bifurcation theory of eigenvalues, which is a key point for the stability and instability studies. ... The material of the book is organized into 12 chapters. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/Mailybaev2000.pdf
• http://mailybaev.imec.msu.ru/papers/KliemEtAl2006.pdf

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>16) - comphep.sinp.msu.ru/ )

• tutorials [CompHEP]

... It was necessary to construct quite a different type of parachute to be light, compact, encased in a parapack and reliable. At first most parachute designers considered it to be hardly possible for a canopy to open in the air without the aid of some special devices, such as an umbrella spokes, compressed air or powder explosive charges. ... Later on a great number of different parachute systems were worked out and introduced by Russian parachute designers Nikolai Lobanov, Igor Glushkov and others. ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>5) - td.chem.msu.ru/ )

... О проекте . ... A source of medical x-?rays based on a 50 Mev storage ring and a quasi-?continues picosecond laser is considered. It is shown that such generator produces useful X-?ray flux with higher average power and higher efficiency than that of conventional X-?ray tubes. ...

Еще в разделе: (Показать все результаты (>8) - miles.sinp.msu.ru/ )

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ... 8.12.2005, 0:27 . ...

Еще в разделе: (Показать все результаты (>1058) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Ассоциации
• Студенческий форум Физфака МГУ > Current Doing
• Студенческий форум Физфака МГУ > Игра "кошка или собака"

... in contrast to smth -showing a difference between people, ideas, situations, things etc that are being compared to a lesser extent-used to say how true smth is or how great or small an effect or change is globally-affecting or including the whole world overall-considering or including everything on the whole anyway-admitting that what was said before doesn't matter, this is the main point but-used to connect two statements or phrases when the second one adds ...

Еще в разделе: (Показать все результаты (>22) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/last_year_theses_by_A_Rakitko.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf
• http://www.eng.math.msu.su/download/section_1.pdf

Databases (NSDC) of the Natural Planetary Satellites. Sources and references of the data . NSDC: Database of astrometric observations of Natural Planetary Satellites . ... The observational data are taken from various sources: . ... The catalogue of observations of the Martian satellites published by Morley T.A. A catalogue of ground-based astrometric observations of the Martian satellites, 1877-1982, Astronomy and Astrophysics Supplement Series. 1989. vol. 77. n. 2. p. 209-226. ...

Еще в разделе: (Показать все результаты (>248) - lnfm1.sai.msu.ru/ )

• Calibration data
• Natural Satellites Service. Apparent Encounters of the Tycho-2 Catalogue stars
• Manpage of FITSHDR

... NetCDF User's Guide for C . ... more standard error behavior, by uniformly communicating an error status back to the calling program in the return value of each function. ... We are hoping that the benefits of the new interface will be an incentive to use it in new netCDF applications. ... The new interface handles errors differently than netCDF-2. ... Where the netCDF-2 interface used NC_LONG to identify an external data type corresponding to 32-bit integers, the new interface uses NC_INT instead. ...

Еще в разделе: (Показать все результаты (>24) - angel.cs.msu.su/ )

• Appendix B File Format Specification
• ExtensionFileFilter
• Appendix A Units

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>18) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• ShielDose2 model - Space monitoring data center

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>11) - oc.cs.msu.ru/ )

... In this paper we present a technique for authorship attribution based on a simple Markov chain of letters (i.e., just letter bigrams are used). ... We show that this technique provides excellent results when applied to over 380 texts from the Project Gutenberg archives, as well as to two previously published data sets. ... They examine the proportion of function words used by an author, and find that this is stable for each author, across a large number of writers in Russian. ... One Text . ...

Еще в разделе: (Показать все результаты (>51) - old.philol.msu.ru/ )

• Konferences
• MSU-LGCLL:: Krylov J.K.- Three Laws of Fiction Prosaic Texts Organization
• MSU-LGCLL:: Papers submitted to QUALICO-94

... Sun , 19 Dec 2010 19:49:53 GMT Daniil Alexeyevsky me.dendik@тАж [41:bcad0f5464bf] * snake.py ( modified ) snake.Rule.load: give reasonable error rather than crash on empty lines Sun , 19 Dec 2010 19:46:39 GMT Daniil Alexeyevsky me.dendik@тАж [40:94945f11c78d] * snake.py ( modified ) snake.Snake.fill: tail takes precedence over body head Sun , 19 Dec 2010 19:45:31 GMT Daniil ...

Еще в разделе: (Показать все результаты (>675) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=2f62804e21fcf2dd9b5fea344b8dd2c7387c3166&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=58%3Ab46dd72b6afe&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=b46dd72b6afeb49e9154d11d1550293b5bcf7a07&limit=100&mode=stop_on_copy

Judging the pedogenic development of soils and paleosols seems simple until more than three kinds of soils are considered. ... SD is commonly described as weak, moderate or strong (or poor, moderate or well), a 3-class system that can be modified with adjectives. ... A scale for ranking soil and paleosol development. ... An effective paleosol classification requires delineation of those key attributes in modern soils with a moderate to high preservation potential following burial and diagenesis. ...

Еще в разделе: (Показать все результаты (>138) - www.fadr.msu.ru/ )

• The Period 1995 - 1999 of the Paleopedology Commission
• Marina Garadzha Farm Management Survey: Preliminary Results
• NEW FARM RESOLUTION (From RUSAG conference)

... School problem is extremely important. ... Our President has mentioned the territorial disparity, i.e. two-thirds of our schools are the rural schools and their graduates are at unequal terms with their equals from cities' schools to get following education. ... Create special conditions in education for disabled children, for orphans and children from unfortunate families, pupils from rural schools and gifted children. ... Ensure social equity for all children during school education and after it. ...

Еще в разделе: (Показать все результаты (>44) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/94.doc
• http://www.rsr-online.ru/doc/norm/396.doc
• http://www.rsr-online.ru/doc/2011_09_26/4.pdf

. [ Войти ] . Главная -> Фильмы -> Automatic . Пользователи . Демо . Деньги . Фильмы . Форум . Automatic . США 2005 . отметить . Драма .

Еще в разделе: (Показать все результаты (>65) - kinfo.ru/ )

• Mahoromatic - Automatic Maid.. - Фильмы - Kinfo.ru
• Automatic (Автоматик) [1994] - Фильм - Фильмы - Kinfo.ru
• The Illustrated Family Doctor - Фильмы - Kinfo.ru