Grigoriev F.V., Golovacheva A.Yu, Romanov A.N., Kondakova O.A., Sulimov A.V., Smolov M.A., Gottikh M.B., Sulimov V.B., Bogolyubov A.A., Kuznetsov Yu V., Dutov M.D. Stability of HIV-1 integrase-ligand complexes: the role of coordinating bonds // Structural Chemistry, 2012, 23, ? 1, с. 185-195. ... The theoretical model is based on the quantum-chemistry calculations of coordinating bonds geometry and energy. ...
... On the 11 th of November there was a birthday of the greatest Russian writer Feodor Dostoevsky. (more.. 19.11.2003 . ... There are people! ... Dolce vita in Russia . ... The new course for foreign students and native Russians is to be started. ... The Russian language centre gives you an opportunity to become a teacher of Russian. (more.. ... Russia is getting closer to the European Community. ... Students, wake up Siberia! ... Russian proverbs and sayings about Russian language: . ...
... Accommodation . ... Dubna & our Venue . ... All accommodation expenses are covered by Organizers . Hotel "Dubna" is located 7-10 minutes from the conference place. ... Please, come first to Registration desk at SINP, DB (Leningradskaya, 12). Call Organizers if you find nobody at the desk (phone numbers are available at the desk). Free Wi-Fi internet access will be available throughout the Hotel Dubna and at the Conference place (hall on the 2nd floor). ...
The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...
Sergey Vladimirovich Petrushanko Afflilation and official address: Skobeltsyn Institute of Nuclear Physics , Lomonosov Moscow State University Leninskiye Gory, Moscow 119991, Russia E-mail: sergeant@mail.cern.ch Date and place of Birth: 24 March 1975, Sverdlovsk (USSR) Citizenship: Russian Federation Education: 2002 Ph.D. (High energy physics ) Skobeltsyn Institute of Nuclear Physics , Lomonosov Moscow ...
Environmental and Climatic Implications of the Morphology of Recent and Paleosols from Loess Exposure at Basaharc, Hungary . Olga MOROZOVA, Research Institute for Soil Science and Agricultural Chemistry HAS, Hermann-Otto-Str. ... These soils are widespread and can be found in most representative Loess exposures in Hungary but as indicated by their name the Loess-Paleosol sequence at Basaharc, on the second terrace of the Danube (100 km N of Budapest), is the key exposures for this type of soils. ...
... The live in the North is a waiting of a vacation and a New Year holiday.. ... Theoretical approach: vacation as a temporal geographic proximity Temporal proximity theory: A. Torre Base for temporal proximity as a solid base of interregional contacts: -The system of two (or more) dwelling (both in the North and the South ) - Social networks Institutional conditions of proximity usage: - A paid vacation trip for all having job in Russian Arctic -Readiness to use weak ...
[
Текст
]
Ссылки http://www.geogr.msu.ru/cafedra/segzs/nauchd/reports/Identity_NZ.pdf -- 1391.6 Кб -- 10.09.2015 Похожие документы
... Personal Data 1.1 1.2 1.3 1.4 1.6 1.8 1.9 Name First Name Other Names (//) Date of Birth (d/m/y) Place of Birth Passport (//) Passport issued (d/m/y) / , / / 1.5 1.7 Sex Citizenship M/M /F / 1.10 valid till / / 2. ... Sending Institution 4.1 4.2 4.3 Ti t l e Faculty / Year / Program / Undergraduate Student / Bachelor course / PhD Student / Other: / Master course 5. Language Skills1 5.1 5.2 5.3 5.4 Russian English Other Necessity for Russian Courses at MSU Certificate to be presented 1 , . ...
[
Текст
]
Ссылки http://www.msu.ru/int/stazh/MSU_exchange.pdf -- 86.6 Кб -- 01.02.2012
[
Текст
]
Ссылки http://www.philol.msu.ru/data/foreign/anketa.pdf -- 86.6 Кб -- 29.01.2009
[
Текст
]
Ссылки http://www.ied.msu.ru/files/MSU_exchange_application_2008.pdf -- 86.6 Кб -- 20.11.2008 Похожие документы
Sign in Register . ... Resources . ... info@ecfs.msu.ru . All contacts . ... Eurasian Center . for Food Security . ... Supported by ECFS, the presentation of the Global Nutrition Report released by IFPRI will take place at MSU (Moscow, Russia) on February 11, 2016. ... ECFS is delighted to invite you to the International Forum on Eurasian Food Security and Nutrition Network and Eurasian Soil Partnership, which will take place on February 29 тАУ March 2, 2016 in Bishkek, Kyrgyz Republic . ...
... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...
Geographic Population Structure (GPS) of worldwide human populations infers biogeographical origin down to home village Eran Elhaik and Tatiana Tatarinova The search for a biogeographical method that utilizes biological information to predict one's place of origin has occupied scientists for millennia. ... GPS's accuracy is demonstrated on three datasets: worldwide populations, Southeast Asians and Oceanians, and Sardinians (Italy) using 40,000 -130,000 GenoChip markers. ...
[
Текст
]
Ссылки http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/153.pdf -- 97.1 Кб -- 07.05.2013 Похожие документы
Luria's ideas in East and West Johnson J.J. Boston University, Department of Psychology, USA, Boston jjjohnson@mail.boston.com Luria's life embodied a contradict ion between personal conformism and intellectual dissent. ... Yes No Luria's ideas in East and West Presentation Boston Universit y, Department of Psycho logy Boston Universit y, Department of Psycho logy USA Boston 02215 Boston Universit y, One Silber Way, Boston, MA 02215, USA +1(617)3532000 +1(123)4567890 jjjo hnson@mail. boston.com Yes ...
[
Текст
]
Ссылки http://www.psy.msu.ru/science/conference/luria/2012/example_en.pdf -- 92.1 Кб -- 02.04.2012 Похожие документы
Dear Colleagues, As you know, JENAM-2007 will take place in Yerevan, Armenia. ... JENAM-2007 will consist of 6 Plenary sessions (invited reviews on hot topics of modern astrophysics, 8 EAS Symposia, and 7 Special Sessions (SPS). ... The opening and closing sessions, EAS symposia and special sessions will be organized in the conference halls and auditoria of the Yerevan State University (YSU). ... The proceedings of the JENAM-2007 will be published in the EAS proceedings series in 2008. ...
... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...
[
Текст
]
Ссылки http://www.fbm.msu.ru/upload/conf/20110201/Information_letter_2011_eng.pdf -- 232.1 Кб -- 11.10.2010
[
Текст
]
Ссылки http://fbm.msu.ru/upload/conf/20110201/Information_letter_2011_eng.pdf -- 232.1 Кб -- 11.10.2010 Похожие документы
Lomonosov Moscow State University Biological faculty Botanical garden (Russia) (http://botsad.msu.ru/eng_news.htm) Botanical garden of the Komarov Botanical institute (Russia) Russian Iris Society Botanical garden of Taurida National Vernadsky University (Ukraine) The second information message Dear colleagues! ... Educational and enlightening activities based on collections of genus Iris L. The program of the Symposium will consist of plenary and sectional sessions as well as poster presentations. ...
[
Текст
]
Ссылки http://www.botsad.msu.ru/docs/eng_iris2.doc -- 901.5 Кб -- 24.02.2011
[
Текст
]
Ссылки http://botsad.msu.ru/docs/eng_iris2.doc -- 901.5 Кб -- 24.02.2011 Похожие документы
... It can be applied to the studies of not only crystalline solids, but also to studies of various disordered, nanocrystalline, amorphous and liquid systems. In our laboratory we use EXAFS to study the local environment of isovalent and nonisovalent impurities in narrow-gap IV-VI semiconductors with a particular emphasis to off-center impurities which can induce the ferroelectric phase transition in these crystals. ... A.I. Lebedev, I.A. Sluchinskaya, V.N. Demin and I.H. Munro. ...
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
Conference . ... 3rd Announcement . 2nd Announcement . ... The 2006 autumn IVOA Interoperability Meeting and Small Project Meeting will be held in Moscow, Russia, from September 18-22. The venue for the meeting are Institute of Astronomy, Sternberg Astronomical Institute and Headquarter of the Russian Academy of Sciences. ... Working Groups: VOTable, UCDs, Registry, Data Models, Data Access Layer, VO Query Language, Grid and Web Services, and VOEvent. Interest Groups: Applications, Theory. ...
Apache2 Ubuntu Default Page . It works! This is the default welcome page used to test the correct operation of the Apache2 server after installation on Ubuntu systems. ... Ubuntu's Apache2 default configuration is different from the upstream default configuration, and split into several files optimized for interaction with Ubuntu tools. ... The configuration layout for an Apache2 web server installation on Ubuntu systems is as follows: /etc/apache2/ |-- apache2.conf | ... Document Roots . ...
... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 8, 1996 . A Solar Corona Ejection . ... One reason, besides the extreme heat, is that explosions are common there . In the above picture, magnetic fields buckle releasing previously constrained hot material from the upper atmosphere of the Sun . ... CMEs are more common but less intense than solar flares . ... About APOD | ...